Query         031939
Match_columns 150
No_of_seqs    11 out of 13
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 07:26:36 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031939.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031939hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04583 Baculo_p74:  Baculovir  56.4     5.9 0.00013   34.1   1.2   13  137-149   119-131 (249)
  2 PF12286 DUF3622:  Protein of u  43.4      11 0.00025   27.3   0.8   18  100-117    48-65  (71)
  3 PF15496 DUF4646:  Domain of un  40.0      42 0.00092   25.1   3.5   60   24-84     10-78  (123)
  4 KOG1412 Aspartate aminotransfe  39.8     7.8 0.00017   35.6  -0.6   52    8-63    260-318 (410)
  5 TIGR03691 20S_bact_alpha prote  36.3      21 0.00045   28.8   1.4   14  104-117    14-27  (228)
  6 PF10319 7TM_GPCR_Srj:  Serpent  27.5      43 0.00094   29.4   2.0   20   98-117   152-171 (310)
  7 PF12348 CLASP_N:  CLASP N term  26.7      47   0.001   25.0   1.8   15    2-16     17-31  (228)
  8 KOG4848 Extracellular matrix-a  26.6      40 0.00088   29.0   1.6   39   89-128    53-91  (225)
  9 PF10199 Adaptin_binding:  Alph  26.3      48   0.001   24.0   1.8   14  100-113   121-134 (137)
 10 PF08350 DUF1724:  Domain of un  20.2      39 0.00085   22.8   0.3   15  100-115    48-62  (64)
 11 PLN02291 phospho-2-dehydro-3-d  20.2      81  0.0018   29.6   2.4   31   75-117    22-52  (474)

No 1  
>PF04583 Baculo_p74:  Baculoviridae p74 conserved region;  InterPro: IPR007663 Baculoviruses are distinct from other virus families in that there are two viral phenotypes: budded virus (BV) and occlusion-derived virus (ODV). BVs disseminate viral infection throughout the tissues of the host and ODVs transmit baculovirus between insect hosts. GFP tagging experiments implicate p74 as an ODV envelope protein [, ].; GO: 0019058 viral infectious cycle
Probab=56.41  E-value=5.9  Score=34.08  Aligned_cols=13  Identities=54%  Similarity=1.270  Sum_probs=10.8

Q ss_pred             HHHHhcCCCCCCC
Q 031939          137 FSLFFWDPFAANG  149 (150)
Q Consensus       137 ~s~~~w~p~~~~~  149 (150)
                      +.+||||||.||.
T Consensus       119 lvL~~WDPfGYnN  131 (249)
T PF04583_consen  119 LVLMFWDPFGYNN  131 (249)
T ss_pred             HHHHhcCcccccc
Confidence            4678999999974


No 2  
>PF12286 DUF3622:  Protein of unknown function (DUF3622);  InterPro: IPR022069  This family of proteins is found in bacteria. Proteins in this family are typically between 72 and 107 amino acids in length. There is a conserved VSK sequence motif. 
Probab=43.42  E-value=11  Score=27.33  Aligned_cols=18  Identities=22%  Similarity=0.820  Sum_probs=15.4

Q ss_pred             ccchHHHHHHHHHHHhhc
Q 031939          100 KWGDEEKREYVRKRLQRK  117 (150)
Q Consensus       100 ~Wg~eerr~Y~rkrl~R~  117 (150)
                      .||++|+.+|+...+-|.
T Consensus        48 ~W~e~eL~~fl~n~~~RN   65 (71)
T PF12286_consen   48 AWGEKELKSFLENQAERN   65 (71)
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            899999999999886553


No 3  
>PF15496 DUF4646:  Domain of unknown function (DUF4646)
Probab=40.04  E-value=42  Score=25.14  Aligned_cols=60  Identities=22%  Similarity=0.294  Sum_probs=48.6

Q ss_pred             CcchhhhhhhcccCCCC-----CCCC---CcccccCCchhHHHHH-HHHHHHHHhhcCCCCCCcccCCCC
Q 031939           24 PPLHSQLFVSSQIPCYL-----NWDY---PPVFCTKFRYIHWRWG-LSLFLRRVSRFGLPQTSWRSKCPY   84 (150)
Q Consensus        24 PsLhSQ~Fias~iPCy~-----~wdY---PP~lC~~~p~~ll~W~-~s~FLkRv~r~glP~tSWRSkCPf   84 (150)
                      |+|=.+-|-..+||+.-     +-.|   |+.|.+-+ -....|. |.=.|...++++-.++.+++++|=
T Consensus        10 ~~lsy~~f~p~~I~s~s~~l~~gFp~~~~P~~l~~~D-Vs~eDW~~F~~dl~~aa~ls~~~~~~~~~~~~   78 (123)
T PF15496_consen   10 PSLSYSPFPPFQIPSRSDSLSSGFPYLYPPPPLASHD-VSEEDWTRFLNDLSEAASLSPSQSIVAGVGPI   78 (123)
T ss_pred             CCCCCCCCCCEEEeecCCccccCCCCcCCCchhhhcC-CCHHHHHHHHHHHHHHHhcCcccceeeeeccc
Confidence            45555677888888873     5667   88888766 6778899 899999999999999889999875


No 4  
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism]
Probab=39.80  E-value=7.8  Score=35.56  Aligned_cols=52  Identities=25%  Similarity=0.472  Sum_probs=42.3

Q ss_pred             HHHHHHHHhhcCCCCCCcchhhhhhhcccCCCCCCCCCcccccC-------CchhHHHHHHHH
Q 031939            8 QKLQALTHVLTSPTNSPPLHSQLFVSSQIPCYLNWDYPPVFCTK-------FRYIHWRWGLSL   63 (150)
Q Consensus         8 qr~qALTHiLT~Pt~sPsLhSQ~Fias~iPCy~~wdYPP~lC~~-------~p~~ll~W~~s~   63 (150)
                      +|+--||-+.-+|++.+-++||+=+.-++    +|++||-+--.       .|.+-.+|.-|+
T Consensus       260 eRvGnltvv~~n~a~i~~v~SQl~lviR~----~~SNPPAyGArIV~kvL~tP~lre~W~~si  318 (410)
T KOG1412|consen  260 ERVGNLTVVVNNPAVIAGVKSQLTLVIRS----NWSNPPAYGARIVHKVLSTPELREQWIQSI  318 (410)
T ss_pred             ccccceEEEecChhHHHHHHHHHHHHHhh----ccCCCcchhhHHHHHHhcCHHHHHHHHHHH
Confidence            56777888999999999999999888765    89999965321       389999998664


No 5  
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type. Members of this family are the alpha subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In most Actinobacteria (an exception is Propionibacterium acnes), the proteasome is accompanied by a system of tagging proteins for degradation with Pup.
Probab=36.26  E-value=21  Score=28.85  Aligned_cols=14  Identities=29%  Similarity=0.525  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHhhc
Q 031939          104 EEKREYVRKRLQRK  117 (150)
Q Consensus       104 eerr~Y~rkrl~R~  117 (150)
                      .+|||||.|-+.+|
T Consensus        14 ~~~~EYA~kav~~g   27 (228)
T TIGR03691        14 RDRAELARKGIARG   27 (228)
T ss_pred             hhHHHHHHHHHHcC
Confidence            58999999998776


No 6  
>PF10319 7TM_GPCR_Srj:  Serpentine type 7TM GPCR chemoreceptor Srj;  InterPro: IPR019423 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  The nematode Caenorhabditis elegans has only 14 types of chemosensory neuron, yet is able to sense and respond to several hundred different chemicals because each neuron detects several stimuli []. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf' []. Chemoreception in C. elegans is mediated by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs). More than 1300 potential chemoreceptor genes have been identified in C. elegans, which are generally prefixed sr for serpentine receptor. The receptor superfamilies include Sra (Sra, Srb, Srab, Sre), Str (Srh, Str, Sri, Srd, Srj, Srm, Srn) and Srg (Srx, Srt, Srg, Sru, Srv, Srxa), as well as the families Srw, Srz, Srbc, Srsx and Srr [, , ]. Many of these proteins have homologues in Caenorhabditis briggsae.  This entry represents serpentine receptor class j (Srj) from the Str superfamily [, ]. The Srj family is designated as the out-group based on its location in preliminary phylogenetic analyses of the entire superfamily []. 
Probab=27.45  E-value=43  Score=29.40  Aligned_cols=20  Identities=25%  Similarity=0.582  Sum_probs=16.8

Q ss_pred             ccccchHHHHHHHHHHHhhc
Q 031939           98 EAKWGDEEKREYVRKRLQRK  117 (150)
Q Consensus        98 ea~Wg~eerr~Y~rkrl~R~  117 (150)
                      -.-|+|+|+|+|+|+-.++.
T Consensus       152 ~~~~ad~EiR~YIre~F~e~  171 (310)
T PF10319_consen  152 FCMYADDEIRDYIRESFREV  171 (310)
T ss_pred             hhcCCCHHHHHHHHHHHHHH
Confidence            34679999999999997776


No 7  
>PF12348 CLASP_N:  CLASP N terminal;  InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ]. The domain is also found in other proteins involved in microtubule binding, including STU1, MOR1 and spindle pole body component Alp14.; PDB: 2QK2_A.
Probab=26.73  E-value=47  Score=24.99  Aligned_cols=15  Identities=27%  Similarity=0.871  Sum_probs=11.5

Q ss_pred             CcchHHHHHHHHHHh
Q 031939            2 DDTTWEQKLQALTHV   16 (150)
Q Consensus         2 e~~TW~qr~qALTHi   16 (150)
                      .+..|+.|.+||+.+
T Consensus        17 ~~~~W~~r~~al~~L   31 (228)
T PF12348_consen   17 SESDWEERVEALQKL   31 (228)
T ss_dssp             T-SSHHHHHHHHHHH
T ss_pred             CccCHHHHHHHHHHH
Confidence            467899999998864


No 8  
>KOG4848 consensus Extracellular matrix-associated peroxidase [Extracellular structures; Defense mechanisms]
Probab=26.62  E-value=40  Score=28.98  Aligned_cols=39  Identities=31%  Similarity=0.504  Sum_probs=31.3

Q ss_pred             cccccccccccccchHHHHHHHHHHHhhcccccccCCccc
Q 031939           89 PLTLAKGVEEAKWGDEEKREYVRKRLQRKRLGCHVNPLIP  128 (150)
Q Consensus        89 Plv~a~gvEea~Wg~eerr~Y~rkrl~R~~l~~~v~P~ip  128 (150)
                      -.|++.|+-+-+|.- +++.|+|+|..|--..++|+|-+.
T Consensus        53 ~~il~~~~pP~~w~~-~~~~y~r~~FgrYGa~SgV~p~~l   91 (225)
T KOG4848|consen   53 RIILAGGMPPVQWDS-ERRAYRRERFGRYGAKSGVPPEEL   91 (225)
T ss_pred             HHHHcCCCCChhhhh-ccHHHHHHHHHhhccccCCChhhh
Confidence            357777888888965 459999999888779999999763


No 9  
>PF10199 Adaptin_binding:  Alpha and gamma adaptin binding protein p34;  InterPro: IPR019341  p34 is a protein involved in membrane trafficking. It is known to interact with both alpha and gamma adaptin []. It has been speculated that p34 may play a chaperone role such as preventing the soluble adaptors from co-assembling with soluble clathrin, or helping to remove the adaptors from the coated vesicle. It may also aid in the recruitment of soluble adaptors onto the membrane []. 
Probab=26.34  E-value=48  Score=24.01  Aligned_cols=14  Identities=29%  Similarity=0.385  Sum_probs=11.8

Q ss_pred             ccchHHHHHHHHHH
Q 031939          100 KWGDEEKREYVRKR  113 (150)
Q Consensus       100 ~Wg~eerr~Y~rkr  113 (150)
                      ...++|||+||.|=
T Consensus       121 ~lpd~qRr~~Aakv  134 (137)
T PF10199_consen  121 SLPDEQRRRMAAKV  134 (137)
T ss_pred             cCCHHHHHHHHHHH
Confidence            57899999999874


No 10 
>PF08350 DUF1724:  Domain of unknown function (DUF1724);  InterPro: IPR013561 This domain of unknown function has so far only been found at the C terminus of archaean proteins, including several transcriptional regulators of the ArsR family (see IPR001845 from INTERPRO). 
Probab=20.23  E-value=39  Score=22.83  Aligned_cols=15  Identities=53%  Similarity=1.010  Sum_probs=10.8

Q ss_pred             ccchHHHHHHHHHHHh
Q 031939          100 KWGDEEKREYVRKRLQ  115 (150)
Q Consensus       100 ~Wg~eerr~Y~rkrl~  115 (150)
                      +||+ |+=+|-+++.+
T Consensus        48 ~WG~-eLF~yY~~~s~   62 (64)
T PF08350_consen   48 KWGE-ELFEYYKKRSE   62 (64)
T ss_pred             HHHH-HHHHHHHHhCc
Confidence            9996 57777777654


No 11 
>PLN02291 phospho-2-dehydro-3-deoxyheptonate aldolase
Probab=20.21  E-value=81  Score=29.64  Aligned_cols=31  Identities=35%  Similarity=0.431  Sum_probs=23.7

Q ss_pred             CCCcccCCCCCCCCcccccccccccccchHHHHHHHHHHHhhc
Q 031939           75 QTSWRSKCPYQQPPPLTLAKGVEEAKWGDEEKREYVRKRLQRK  117 (150)
Q Consensus        75 ~tSWRSkCPfq~PPPlv~a~gvEea~Wg~eerr~Y~rkrl~R~  117 (150)
                      ++|||++==-|            +-.|.|++.-+.|.++|++-
T Consensus        22 p~sWr~~pa~Q------------qP~y~D~~~l~~v~~~L~~~   52 (474)
T PLN02291         22 PDSWRSKKALQ------------LPEYPDQAELEEVLKTLEAF   52 (474)
T ss_pred             hhhhhcCcccc------------CCCCCCHHHHHHHHHHHhcC
Confidence            78999993333            34699999999999997664


Done!