Query         031940
Match_columns 150
No_of_seqs    80 out of 101
Neff          3.0 
Searched_HMMs 46136
Date          Fri Mar 29 07:27:30 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031940.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031940hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02792 Mago_nashi:  Mago nash 100.0  5E-102  1E-106  606.9  12.9  143    8-150     1-143 (143)
  2 KOG3392 Exon-exon junction com 100.0 3.3E-98  7E-103  582.0  11.8  146    5-150     2-147 (147)
  3 KOG1446 Histone H3 (Lys4) meth  55.8       6 0.00013   35.4   1.2   27   73-107   182-208 (311)
  4 PF14250 AbrB-like:  AbrB-like   49.8      15 0.00033   26.7   2.3   14   90-103    57-70  (71)
  5 PHA01548 hypothetical protein   46.8      26 0.00056   28.8   3.4   32   55-98    119-151 (167)
  6 PRK14947 DNA polymerase III su  36.3 1.8E+02  0.0038   25.6   7.2   36   53-107   196-231 (384)
  7 PF01985 CRS1_YhbY:  CRS1 / Yhb  32.3      31 0.00067   24.3   1.6   22   55-76     26-47  (84)
  8 PF02767 DNA_pol3_beta_2:  DNA   31.0 1.5E+02  0.0033   21.1   5.1   41   51-108    63-103 (116)
  9 PF05261 Tra_M:  TraM protein,   27.5      41 0.00088   26.8   1.7   22   49-70      1-22  (127)
 10 PF14258 DUF4350:  Domain of un  26.9      43 0.00094   21.9   1.5   17  117-133     1-17  (70)
 11 PF11743 DUF3301:  Protein of u  26.8      36 0.00079   24.8   1.2   32   18-49     57-89  (97)
 12 PF11888 DUF3408:  Protein of u  25.5      67  0.0014   24.5   2.5   24   47-70     76-99  (136)
 13 PF11211 DUF2997:  Protein of u  24.6      51  0.0011   21.7   1.5   13   26-38      1-13  (48)
 14 PF10584 Proteasome_A_N:  Prote  24.3      34 0.00073   19.9   0.5    7   30-36      8-14  (23)
 15 cd03688 eIF2_gamma_II eIF2_gam  22.2 1.4E+02  0.0031   23.1   3.7   31   86-117    41-78  (113)
 16 PRK10343 RNA-binding protein Y  22.1      69  0.0015   23.9   2.0   36   54-92     27-62  (97)
 17 PF02210 Laminin_G_2:  Laminin   21.0 1.4E+02   0.003   20.1   3.1   20   23-43     19-38  (128)
 18 PF00989 PAS:  PAS fold;  Inter  20.9      58  0.0013   20.9   1.2   45   28-72     15-70  (113)
 19 PF04900 Fcf1:  Fcf1;  InterPro  20.5      95  0.0021   22.0   2.3   18   53-70      9-26  (101)

No 1  
>PF02792 Mago_nashi:  Mago nashi protein;  InterPro: IPR004023 This family was originally identified in drosophila and called mago nashi, it is a strict maternal effect, grandchildless-like, gene []. The human homologue has been shown to interact with an RNA binding protein, ribonucleoprotein rbm8 (Q9Y5S9 from SWISSPROT) []. An RNAi knockout of the Caenorhabditis elegans homologue causes masculinization of the germ line (Mog phenotype) hermaphrodites, suggesting it is involved in hermaphrodite germ-line sex determination [] but the protein is also found in hermaphrodites and other organisms without a sexual differentiation.; GO: 0005634 nucleus; PDB: 2XB2_Y 2J0S_C 3EX7_A 2J0Q_F 1P27_C 2HYI_A 2X1G_B 1HL6_B 1RK8_B 1OO0_A ....
Probab=100.00  E-value=5.2e-102  Score=606.89  Aligned_cols=143  Identities=88%  Similarity=1.443  Sum_probs=132.9

Q ss_pred             ceEEEEeecCCCccceeeEEEEEcCCCceEeeccCCCCCcceEEEEEeeCHHHHHHHHHHhhhcccccccCCCCCCCCCC
Q 031940            8 EFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRV   87 (150)
Q Consensus         8 ~FYlRYY~Gh~GkfGHEFLEfEf~~dG~lRYaNNSnYKnd~~IrKe~~vs~~v~~E~krII~~SeI~kEdD~~WP~pd~~   87 (150)
                      +||||||+||+||||||||||||||||+||||||||||||+||||||+||++||+|+||||.+||||+|||++||+||++
T Consensus         1 ~fYlRYy~gH~GkfGhEfLEfEfr~dG~lRYaNnSnYknd~~IrKe~~vs~~vl~E~krII~~SeI~kEdD~~WP~pd~~   80 (143)
T PF02792_consen    1 DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDSMIRKEVYVSPAVLEELKRIIEDSEIMKEDDSKWPEPDRV   80 (143)
T ss_dssp             -EEEEEEEEEEETTEEEEEEEEEETTSEEEEEEEESCCCSEEEEEEEEE-HHHHHHHHHHHHHHTGGG--STTS--SBTT
T ss_pred             CeeEEEEeccCccccceEEEEEeccCCeEEEcccCCCCCcceeeeeeEecHHHHHHHHHHHHHhhccccccccCCCCCCc
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeEEEEECCeEEEEEecCeeeeeeccCCCCccchhhhhHHHHhHHHHHHHHhhhceeeecC
Q 031940           88 GRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI  150 (150)
Q Consensus        88 GrQELEI~~g~~HisF~tsKiGSl~dv~~S~DPeGLr~FyYLvqDLkclvfsLi~lHfkikpi  150 (150)
                      |||||||+|||+||||+|||||||+|||+|+||||||+||||||||||||||||+||||||||
T Consensus        81 GrQELEI~lg~~HisF~tsKigsl~dv~~S~DPeGLr~FyYLvqDLKclvfsLi~lHFkikpi  143 (143)
T PF02792_consen   81 GRQELEIVLGNEHISFTTSKIGSLSDVQNSKDPEGLRVFYYLVQDLKCLVFSLISLHFKIKPI  143 (143)
T ss_dssp             BEEEEEEEETTEEEEEEEC---SHHHHHTSSSHHHHHHHHHHHHHHHHHHHHHHHHHHTSSS-
T ss_pred             cceeEEEEECCEEEEEEecccccceeeccCCCccHHHHHHHHHHHHHHHHHHHHHheeeeccC
Confidence            999999999999999999999999999999999999999999999999999999999999998


No 2  
>KOG3392 consensus Exon-exon junction complex, Magoh component [RNA processing and modification]
Probab=100.00  E-value=3.3e-98  Score=581.97  Aligned_cols=146  Identities=84%  Similarity=1.381  Sum_probs=144.4

Q ss_pred             CCcceEEEEeecCCCccceeeEEEEEcCCCceEeeccCCCCCcceEEEEEeeCHHHHHHHHHHhhhcccccccCCCCCCC
Q 031940            5 EDGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFLTPAVLRECRRIISESEIMKEDDNNWPEP   84 (150)
Q Consensus         5 ~~~~FYlRYY~Gh~GkfGHEFLEfEf~~dG~lRYaNNSnYKnd~~IrKe~~vs~~v~~E~krII~~SeI~kEdD~~WP~p   84 (150)
                      ...+|||||||||+||||||||||||||||+||||||||||||+|||||++||++|++|+||||.|||||+|||++||+|
T Consensus         2 ~asdfy~ryyvghkgkfgheflefefr~dg~lryannsnykndt~irke~fv~e~vl~e~kriv~dsei~kedd~nwp~p   81 (147)
T KOG3392|consen    2 EASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHESVLEELKRIIDDSEIMKEDDANWPPP   81 (147)
T ss_pred             cccceEEEEEeccCccccceeeEEEecCCCcEEeccCCCcccchhhhhhhhhhHHHHHHHHHHhhhhhhhhccccCCcCC
Confidence            46789999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEEECCeEEEEEecCeeeeeeccCCCCccchhhhhHHHHhHHHHHHHHhhhceeeecC
Q 031940           85 DRVGRQELEIVMGNEHISFTTSKIGSLVDVQSSKDPEGLRIFYYLVQDLKCFVFSLISLHFKIKPI  150 (150)
Q Consensus        85 d~~GrQELEI~~g~~HisF~tsKiGSl~dv~~S~DPeGLr~FyYLvqDLkclvfsLi~lHfkikpi  150 (150)
                      |++|||||||+|||+||||+|||||||+|||+|+||||||+||||||||||||||||+||||||||
T Consensus        82 d~~gkqelei~~~~ehisf~t~kigsladv~ns~dpeglr~fyylvqdlkclvfsli~lhfkikpi  147 (147)
T KOG3392|consen   82 DRVGRQELEIVIGDEHISFTTSKIGSLADVNNSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI  147 (147)
T ss_pred             CcccceeEEEEECCeEEEEEeccccceeecccCCCccceeeehhhHhhhHhHhhhheeeeEEeecC
Confidence            999999999999999999999999999999999999999999999999999999999999999997


No 3  
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones]
Probab=55.83  E-value=6  Score=35.36  Aligned_cols=27  Identities=26%  Similarity=0.554  Sum_probs=19.1

Q ss_pred             cccccCCCCCCCCCCCceeEEEEECCeEEEEEecC
Q 031940           73 IMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSK  107 (150)
Q Consensus        73 I~kEdD~~WP~pd~~GrQELEI~~g~~HisF~tsK  107 (150)
                      |..+|-+.|        .+||..=+|+-|=.+|..
T Consensus       182 i~~~~~~ew--------~~l~FS~dGK~iLlsT~~  208 (311)
T KOG1446|consen  182 ITDNDEAEW--------TDLEFSPDGKSILLSTNA  208 (311)
T ss_pred             cCCCCccce--------eeeEEcCCCCEEEEEeCC
Confidence            334666667        578888888888777755


No 4  
>PF14250 AbrB-like:  AbrB-like transcriptional regulator
Probab=49.76  E-value=15  Score=26.65  Aligned_cols=14  Identities=43%  Similarity=0.835  Sum_probs=12.8

Q ss_pred             eeEEEEECCeEEEE
Q 031940           90 QELEIVMGNEHISF  103 (150)
Q Consensus        90 QELEI~~g~~HisF  103 (150)
                      ||.||.+|-+||-+
T Consensus        57 dEFeI~LgrKhI~L   70 (71)
T PF14250_consen   57 DEFEIKLGRKHIHL   70 (71)
T ss_pred             CEEEEEeCcceEEe
Confidence            89999999999964


No 5  
>PHA01548 hypothetical protein
Probab=46.80  E-value=26  Score=28.81  Aligned_cols=32  Identities=34%  Similarity=0.569  Sum_probs=23.1

Q ss_pred             eeCHHHHHHHHHHhhhcccccccCCCC-CCCCCCCceeEEEEECC
Q 031940           55 FLTPAVLRECRRIISESEIMKEDDNNW-PEPDRVGRQELEIVMGN   98 (150)
Q Consensus        55 ~vs~~v~~E~krII~~SeI~kEdD~~W-P~pd~~GrQELEI~~g~   98 (150)
                      .+|+.|+..|+|||.=     --++.| |+|       |||+.+.
T Consensus       119 a~SQgVVssIQkiisI-----vGpapwt~EP-------l~iVp~e  151 (167)
T PHA01548        119 AVSQGVVSSIQKIISI-----VGPAPWTDEP-------LAIVPGE  151 (167)
T ss_pred             eehHHHHHHHHHHHHH-----hCCCCCCCCC-------eeEEEEE
Confidence            3899999999999963     245555 977       6666553


No 6  
>PRK14947 DNA polymerase III subunit beta; Provisional
Probab=36.30  E-value=1.8e+02  Score=25.61  Aligned_cols=36  Identities=17%  Similarity=0.410  Sum_probs=29.3

Q ss_pred             EEeeCHHHHHHHHHHhhhcccccccCCCCCCCCCCCceeEEEEECCeEEEEEecC
Q 031940           53 EVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSK  107 (150)
Q Consensus        53 e~~vs~~v~~E~krII~~SeI~kEdD~~WP~pd~~GrQELEI~~g~~HisF~tsK  107 (150)
                      .+-|..-.+.||+|++.+                   .+++|.+++.|+.|.+..
T Consensus       196 ~~iIP~k~l~el~kll~~-------------------~~v~i~~~~~~i~f~~~~  231 (384)
T PRK14947        196 GILIQKKYLLELKKWLGA-------------------DEIELSISEKRLFFRTGD  231 (384)
T ss_pred             cEEEechHHHHHHHhCCC-------------------CcEEEEEeCCEEEEEECC
Confidence            567888889999999741                   178999999999998764


No 7  
>PF01985 CRS1_YhbY:  CRS1 / YhbY (CRM) domain;  InterPro: IPR001890 The CRM domain is an ~100-amino acid RNA-binding domain. The name chloroplast RNA splicing and ribosome maturation (CRM) has been suggested to reflect the functions established for the four characterised members of the family: Zea mays (Maize) CRS1 (Q9FYT6 from SWISSPROT), CAF1 (Q84N49 from SWISSPROT) and CAF2 (Q84N48 from SWISSPROT) proteins and the Escherichia coli protein YhbY (P0AGK4 from SWISSPROT). The CRM domain is found in eubacteria, archaea, and plants. The CRM domain is represented as a stand-alone protein in archaea and bacteria, and in single- and multi-domain proteins in plants. It has been suggested that prokaryotic CRM proteins existed as ribosome-associated proteins prior to the divergence of archaea and bacteria, and that they were co-opted in the plant lineage as RNA binding modules by incorporation into diverse protein contexts. Plant CRM domains are predicted to reside not only in the chloroplast, but also in the mitochondrion and the nucleo/cytoplasmic compartment. The diversity of the CRM domain family in plants suggests a diverse set of RNA targets [, ]. The CRM domain is a compact alpha/beta domain consisting of a four-stranded beta sheet and three alpha helices with an alpha-beta-alpha-beta-alpha-beta-beta topology. The beta sheet face is basic, consistent with a role in RNA binding. Proximal to the basic beta sheet face is another moiety that could contribute to nucleic acid recognition. Connecting strand beta1 and helix alpha2 is a loop with a six amino acid motif, GxxG flanked by large aliphatic residues, within which one 'x' is typically a basic residue [].   Escherichia coli YhbY is associated with pre-50S ribosomal subunits, which implies a function in ribosome assembly. GFP fused to a single-domain CRM protein from maize localises to the nucleolus, suggesting that an analogous activity may have been retained in plants []. A CRM domain containing protein in plant chloroplasts has been shown to function in group I and II intron splicing []. In vitro experiments with an isolated maize CRM domain have shown it to have RNA binding activity. These and other results suggest that the CRM domain evolved in the context of ribosome function prior to the divergence of Archaea and Bacteria, that this function has been maintained in extant prokaryotes, and that the domain was recruited to serve as an RNA binding module during the evolution of plant genomes []. YhbY has a fold similar to that of the C-terminal domain of translation initiation factor 3 (IF3C), which binds to 16S rRNA in the 30S ribosome [].; GO: 0003723 RNA binding; PDB: 1RQ8_A 1JO0_B 1LN4_A.
Probab=32.26  E-value=31  Score=24.26  Aligned_cols=22  Identities=27%  Similarity=0.336  Sum_probs=18.6

Q ss_pred             eeCHHHHHHHHHHhhhcccccc
Q 031940           55 FLTPAVLRECRRIISESEIMKE   76 (150)
Q Consensus        55 ~vs~~v~~E~krII~~SeI~kE   76 (150)
                      -++++|++|+.+-++.+|++|-
T Consensus        26 Glt~~vi~~i~~~l~~~eLvKV   47 (84)
T PF01985_consen   26 GLTDGVIEEIDDALEKHELVKV   47 (84)
T ss_dssp             SS-HHHHHHHHHHHHHHSEEEE
T ss_pred             CCCHHHHHHHHHHHHhCCeeEE
Confidence            4799999999999999998763


No 8  
>PF02767 DNA_pol3_beta_2:  DNA polymerase III beta subunit, central domain;  InterPro: IPR022637 This entry describes the central domain of the beta chain of DNA polymerase III. This is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. The beta chain is required for initiation of replication from an RNA primer, nucleotide triphosphate (dNTP) residues being added to the 5'-end of the growing DNA chain.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0008408 3'-5' exonuclease activity, 0006260 DNA replication, 0009360 DNA polymerase III complex; PDB: 3T0P_B 3P16_A 3RB9_B 2AWA_C 1VPK_A 2AVT_B 2XUR_B 3Q4K_A 3BEP_A 3D1G_A ....
Probab=30.97  E-value=1.5e+02  Score=21.10  Aligned_cols=41  Identities=24%  Similarity=0.523  Sum_probs=33.1

Q ss_pred             EEEEeeCHHHHHHHHHHhhhcccccccCCCCCCCCCCCceeEEEEECCeEEEEEecCe
Q 031940           51 RKEVFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTSKI  108 (150)
Q Consensus        51 rKe~~vs~~v~~E~krII~~SeI~kEdD~~WP~pd~~GrQELEI~~g~~HisF~tsKi  108 (150)
                      ..++-|....+.||+|++.++     +            .+++|.+++.++.|.+..+
T Consensus        63 ~~~~iIp~k~l~~l~k~l~~~-----~------------~~v~i~~~~~~i~f~~~~~  103 (116)
T PF02767_consen   63 EFSFIIPAKALKELKKLLSDE-----D------------EEVEISISDNQIIFKFDNI  103 (116)
T ss_dssp             EEEEEEEHHHHHHHHHHSSTT-----S------------SEEEEEEESSEEEEEESSE
T ss_pred             ceEEEEechHHHHHhhhcccC-----C------------ceEEEEEcCCEEEEEECCE
Confidence            466889999999999998761     1            3688999999999998763


No 9  
>PF05261 Tra_M:  TraM protein, DNA-binding;  InterPro: IPR007925 The TraM protein is an essential part of the DNA transfer machinery of the conjugative resistance plasmid R1 (IncFII). On the basis of mutational analyses, it was shown that the essential transfer protein TraM has at least two functions. First, a functional TraM protein was found to be required for normal levels of transfer gene expression. Second, experimental evidence was obtained that TraM stimulates efficient site-specific single-stranded DNA cleavage at the oriT, in vivo. Furthermore, a specific interaction of the cytoplasmic TraM protein with the membrane protein TraD was demonstrated, suggesting that the TraM protein creates a physical link between the relaxosomal nucleoprotein complex and the membrane-bound DNA transfer apparatus [].; GO: 0003677 DNA binding, 0000746 conjugation; PDB: 3ON0_A 3OMY_B 1DP3_A 2G9E_A 3D8A_B 2G7O_A.
Probab=27.46  E-value=41  Score=26.79  Aligned_cols=22  Identities=32%  Similarity=0.573  Sum_probs=16.8

Q ss_pred             eEEEEEeeCHHHHHHHHHHhhh
Q 031940           49 MIRKEVFLTPAVLRECRRIISE   70 (150)
Q Consensus        49 ~IrKe~~vs~~v~~E~krII~~   70 (150)
                      |=|..+||+..|.++|..|+.+
T Consensus         1 M~rvq~y~s~~v~~~I~~iVe~   22 (127)
T PF05261_consen    1 MPRVQIYVSNKVLEEINDIVEE   22 (127)
T ss_dssp             --EECCE--HCHHHHHHHHHHH
T ss_pred             CCchhhhhhHHHHHHHHHHHHH
Confidence            4588999999999999999976


No 10 
>PF14258 DUF4350:  Domain of unknown function (DUF4350)
Probab=26.87  E-value=43  Score=21.89  Aligned_cols=17  Identities=24%  Similarity=0.548  Sum_probs=14.8

Q ss_pred             CCCccchhhhhHHHHhH
Q 031940          117 SKDPEGLRIFYYLVQDL  133 (150)
Q Consensus       117 S~DPeGLr~FyYLvqDL  133 (150)
                      |++|.|.+.||-+.++.
T Consensus         1 ~~~p~G~~a~~~~L~~~   17 (70)
T PF14258_consen    1 NPAPNGTYALYQLLEEQ   17 (70)
T ss_pred             CCCchHHHHHHHHHHHC
Confidence            57899999999988875


No 11 
>PF11743 DUF3301:  Protein of unknown function (DUF3301);  InterPro: IPR021732  This family is conserved in Proteobacteria, but the function is not known. 
Probab=26.76  E-value=36  Score=24.83  Aligned_cols=32  Identities=25%  Similarity=0.540  Sum_probs=20.9

Q ss_pred             CCccc-eeeEEEEEcCCCceEeeccCCCCCcce
Q 031940           18 KGKFG-HEFLEFEFRPDGKLRYANNSNYKNDTM   49 (150)
Q Consensus        18 ~GkfG-HEFLEfEf~~dG~lRYaNNSnYKnd~~   49 (150)
                      .|+.+ +---.|||++||.-||.-.=-..+..+
T Consensus        57 ~g~~~~~r~y~FEFS~~G~~ry~G~l~m~G~~l   89 (97)
T PF11743_consen   57 RGRLRWRRVYQFEFSSDGEDRYQGELVMLGRRL   89 (97)
T ss_pred             CCCeEEEEEEEEEEeCCChhcceEEEEEECCee
Confidence            45555 344579999999999876544444433


No 12 
>PF11888 DUF3408:  Protein of unknown function (DUF3408);  InterPro: IPR021823  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 128 to 160 amino acids in length. 
Probab=25.51  E-value=67  Score=24.47  Aligned_cols=24  Identities=21%  Similarity=0.329  Sum_probs=19.9

Q ss_pred             cceEEEEEeeCHHHHHHHHHHhhh
Q 031940           47 DTMIRKEVFLTPAVLRECRRIISE   70 (150)
Q Consensus        47 d~~IrKe~~vs~~v~~E~krII~~   70 (150)
                      ..--||-||||+.+-+-|.||+..
T Consensus        76 ~~~~R~~vyI~~e~h~~l~~Iv~~   99 (136)
T PF11888_consen   76 KIKARKGVYISRETHERLSRIVRV   99 (136)
T ss_pred             CCCCCeeeEECHHHHHHHHHHHHH
Confidence            344578899999999999999864


No 13 
>PF11211 DUF2997:  Protein of unknown function (DUF2997);  InterPro: IPR021375  This family of proteins has no known function. 
Probab=24.61  E-value=51  Score=21.65  Aligned_cols=13  Identities=38%  Similarity=0.861  Sum_probs=10.3

Q ss_pred             EEEEEcCCCceEe
Q 031940           26 LEFEFRPDGKLRY   38 (150)
Q Consensus        26 LEfEf~~dG~lRY   38 (150)
                      +||.++|||+++-
T Consensus         1 I~~~I~~dG~V~~   13 (48)
T PF11211_consen    1 IEFTIYPDGRVEE   13 (48)
T ss_pred             CEEEECCCcEEEE
Confidence            5788899998763


No 14 
>PF10584 Proteasome_A_N:  Proteasome subunit A N-terminal signature;  InterPro: IPR000426 The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). This family contains the alpha subunit sequences which range from 210 to 290 amino acids. These sequences are classified as non-peptidase homologues in MEROPS peptidase family T1 (clan PB(T)). ; GO: 0004175 endopeptidase activity, 0006511 ubiquitin-dependent protein catabolic process, 0019773 proteasome core complex, alpha-subunit complex; PDB: 3H4P_M 1IRU_O 3UN4_U 1FNT_A 3OEV_G 3OEU_U 3SDK_U 3DY3_G 3MG7_G 3L5Q_C ....
Probab=24.27  E-value=34  Score=19.88  Aligned_cols=7  Identities=71%  Similarity=1.540  Sum_probs=5.8

Q ss_pred             EcCCCce
Q 031940           30 FRPDGKL   36 (150)
Q Consensus        30 f~~dG~l   36 (150)
                      |+|||||
T Consensus         8 FSp~Grl   14 (23)
T PF10584_consen    8 FSPDGRL   14 (23)
T ss_dssp             BBTTSSB
T ss_pred             ECCCCeE
Confidence            6799986


No 15 
>cd03688 eIF2_gamma_II eIF2_gamma_II: this subfamily represents the domain II of the gamma subunit of eukaryotic translation initiation factor 2 (eIF2-gamma) found in Eukaryota and Archaea. eIF2 is a G protein that delivers the methionyl initiator tRNA to the small ribosomal subunit and releases it upon GTP hydrolysis after the recognition of the initiation codon. eIF2 is composed three subunits, alpha, beta and gamma. Subunit gamma shows strongest conservation, and it confers both tRNA binding and GTP/GDP binding.
Probab=22.16  E-value=1.4e+02  Score=23.13  Aligned_cols=31  Identities=32%  Similarity=0.328  Sum_probs=18.7

Q ss_pred             CCCceeEEEEEC-------CeEEEEEecCeeeeeeccCC
Q 031940           86 RVGRQELEIVMG-------NEHISFTTSKIGSLVDVQSS  117 (150)
Q Consensus        86 ~~GrQELEI~~g-------~~HisF~tsKiGSl~dv~~S  117 (150)
                      ++| ||+||+-|       +....--+++|-||..-++.
T Consensus        41 kvg-deIEIrpg~~~~~~~~~~~~pi~T~I~sl~~~~~~   78 (113)
T cd03688          41 KVG-DEIEIRPGIVVKDEGKIKCRPIFTKIVSLKAENND   78 (113)
T ss_pred             eCC-CEEEEeeceeeecCCCeeEEEEEEEEEEEEecCcc
Confidence            467 89999955       11111235678888766654


No 16 
>PRK10343 RNA-binding protein YhbY; Provisional
Probab=22.14  E-value=69  Score=23.89  Aligned_cols=36  Identities=25%  Similarity=0.283  Sum_probs=27.1

Q ss_pred             EeeCHHHHHHHHHHhhhcccccccCCCCCCCCCCCceeE
Q 031940           54 VFLTPAVLRECRRIISESEIMKEDDNNWPEPDRVGRQEL   92 (150)
Q Consensus        54 ~~vs~~v~~E~krII~~SeI~kEdD~~WP~pd~~GrQEL   92 (150)
                      --+|++|++|+.+-++..|++|-.   |...++.-|+|+
T Consensus        27 ~Glt~~vi~ei~~aL~~hELIKvk---v~~~~~~~~~e~   62 (97)
T PRK10343         27 NGLTEGVLAEIEQALEHHELIKVK---IATEDRETKTLI   62 (97)
T ss_pred             CCCCHHHHHHHHHHHHHCCcEEEE---ecCCChhHHHHH
Confidence            358999999999999999988853   555555445443


No 17 
>PF02210 Laminin_G_2:  Laminin G domain;  InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function []. The laminin globular (G) domain can be found in one to several copies in various laminin family members, including a large number of extracellular proteins. The C terminus of the laminin alpha chain contains a tandem repeat of five laminin G domains, which are critical for heparin-binding and cell attachment activity []. Laminin alpha4 is distributed in a variety of tissues including peripheral nerves, dorsal root ganglion, skeletal muscle and capillaries; in the neuromuscular junction, it is required for synaptic specialisation []. The structure of the laminin-G domain has been predicted to resemble that of pentraxin [].  Laminin G domains can vary in their function, and a variety of binding functions have been ascribed to different LamG modules. For example, the laminin alpha1 and alpha2 chains each have five C-teminal laminin G domains, where only domains LG4 and LG5 contain binding sites for heparin, sulphatides and the cell surface receptor dystroglycan []. Laminin G-containing proteins appear to have a wide variety of roles in cell adhesion, signalling, migration, assembly and differentiation. This entry represents one subtype of laminin G domains, which is sometimes found in association with thrombospondin-type laminin G domains (IPR012679 from INTERPRO).; PDB: 3POY_A 3QCW_B 3R05_B 3ASI_A 3MW4_B 3MW3_A 1QU0_D 1DYK_A 1OKQ_A 3SH4_A ....
Probab=20.96  E-value=1.4e+02  Score=20.07  Aligned_cols=20  Identities=35%  Similarity=0.552  Sum_probs=16.3

Q ss_pred             eeeEEEEEcCCCceEeeccCC
Q 031940           23 HEFLEFEFRPDGKLRYANNSN   43 (150)
Q Consensus        23 HEFLEfEf~~dG~lRYaNNSn   43 (150)
                      ..|+..++. ||+|++.=+..
T Consensus        19 ~~~l~l~l~-~g~l~~~~~~g   38 (128)
T PF02210_consen   19 GDFLSLELV-DGRLVVRYNLG   38 (128)
T ss_dssp             SEEEEEEEE-TTEEEEEEESS
T ss_pred             CEEEEEEEE-CCEEEEEEEcc
Confidence            789999997 99988765555


No 18 
>PF00989 PAS:  PAS fold;  InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain []. PAS domains appear in archaea, bacteria and eukaryotes. Several PAS-domain proteins are known to detect their signal by way of an associated cofactor. Haeme, flavin, and a 4-hydroxycinnamyl chromophore are used in different proteins. The PAS domain was named after three proteins that it occurs in:  Per- period circadian protein Arnt- Ah receptor nuclear translocator protein Sim- single-minded protein. PAS domains are often associated with PAC domains IPR001610 from INTERPRO. It appears that these domains are directly linked, and that together they form the conserved 3D PAS fold. The division between the PAS and PAC domains is caused by major differences in sequences in the region connecting these two motifs []. In human PAS kinase, this region has been shown to be very flexible, and adopts different conformations depending on the bound ligand []. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels [].; GO: 0006355 regulation of transcription, DNA-dependent; PDB: 2GJ3_A 4F3L_B 1XFN_A 1OTD_A 2PYR_A 1KOU_A 1XFQ_A 2ZOI_A 2ZOH_A 1OTA_A ....
Probab=20.89  E-value=58  Score=20.89  Aligned_cols=45  Identities=29%  Similarity=0.650  Sum_probs=29.8

Q ss_pred             EEEcCCCceEeeccC-----CCCCcceEEEEEe--eCHH----HHHHHHHHhhhcc
Q 031940           28 FEFRPDGKLRYANNS-----NYKNDTMIRKEVF--LTPA----VLRECRRIISESE   72 (150)
Q Consensus        28 fEf~~dG~lRYaNNS-----nYKnd~~IrKe~~--vs~~----v~~E~krII~~Se   72 (150)
                      +-++.+|++.|+|.+     +|..+.++-|-+.  +.+.    ..+.++..+...+
T Consensus        15 ~~~d~~g~I~~~N~a~~~l~g~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~   70 (113)
T PF00989_consen   15 FVIDEDGRILYVNQAAEELLGYSREELIGKSLFDLIHPEDRRELRERLRQALSQGE   70 (113)
T ss_dssp             EEEETTSBEEEECHHHHHHHSS-HHHHTTSBGGGGCSGGGHHHHHHHHHHHHHHCC
T ss_pred             EEEeCcCeEEEECHHHHHHHccCHHHHcCCcHHHhcCchhhHHHHHHHHHHHHcCC
Confidence            446799999999987     4777777776644  3333    6666666666554


No 19 
>PF04900 Fcf1:  Fcf1;  InterPro: IPR006984 This family is comprises of uncharacterised eukaryotic proteins.
Probab=20.53  E-value=95  Score=21.96  Aligned_cols=18  Identities=22%  Similarity=0.349  Sum_probs=15.5

Q ss_pred             EEeeCHHHHHHHHHHhhh
Q 031940           53 EVFLTPAVLRECRRIISE   70 (150)
Q Consensus        53 e~~vs~~v~~E~krII~~   70 (150)
                      +.+|++.|++||+++-..
T Consensus         9 ~~~vt~cVl~EL~~L~~~   26 (101)
T PF04900_consen    9 KPYVTQCVLEELESLGKK   26 (101)
T ss_pred             EEEecHHHHHHHHHhccc
Confidence            578999999999998744


Done!