Citrus Sinensis ID: 031975


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGRGREDGASGRQTKGIGRGLDDGGAKGAGGGRGRGGPGGKPGGSRGGGRSRG
cccHHHHHHccccEEEEEEccccEEEEEEEEEcccccEEEEEEEEEcccccccccccEEEEEccEEEEEEccHHHHcHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHHHHHccccEEEEEEcccEEcEEEEEccccEEEEEEEEEEEcccccEEEEccEEEEEccEEEEEEccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mlplsllktaqghpmlvelkngetynghlvncdtwmniHLREVIctskdgdrfwrmpecyirgntikylrvpdEVIDKVQEEtksrsdrkppgvgrgrgrgredgasgrqtkgigrglddggakgagggrgrggpggkpggsrgggrsrg
mlplsllktaqghPMLVELKNGETYNGHLVNCDTWMNIHLREVIctskdgdrfwrMPECYirgntikylrvpdEVIDKVqeetksrsdrkppgvgrgrgrgredgasgrqtkgigrglddggakgagggrgrggpggkpggsrgggrsrg
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPgvgrgrgrgredgasgrQTKGIgrglddggakgagggrgrggpggkpggsrgggrsrg
*************PMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVI**************************************************************************
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVID*************************************************************************
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQ******************************TKGIGRGLDDGGA***************************
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKS*****************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGRGREDGASGRQTKGIGRGLDDGGAKGAGGGRGRGGPGGKPGGSRGGGRSRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q43582146 Probable U6 snRNA-associa N/A no 0.8 0.821 0.909 6e-61
Q9ZRU9148 Probable U6 snRNA-associa N/A no 0.92 0.932 0.826 7e-55
Q9LGE6147 Probable U6 snRNA-associa yes no 0.686 0.700 0.808 4e-47
Q9QXA5137 U6 snRNA-associated Sm-li yes no 0.6 0.656 0.752 8e-41
Q9Y4Z0139 U6 snRNA-associated Sm-li yes no 0.573 0.618 0.825 1e-40
Q3ZBK6139 U6 snRNA-associated Sm-li yes no 0.573 0.618 0.825 1e-40
Q54KX4177 Probable U6 snRNA-associa yes no 0.8 0.677 0.563 1e-35
Q19952123 Probable U6 snRNA-associa yes no 0.553 0.674 0.722 6e-33
O14352121 Probable U6 snRNA-associa yes no 0.546 0.677 0.670 5e-29
P40070187 U6 snRNA-associated Sm-li yes no 0.693 0.556 0.368 4e-14
>sp|Q43582|LSM4_TOBAC Probable U6 snRNA-associated Sm-like protein LSm4 OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function desciption
 Score =  232 bits (592), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 110/121 (90%), Positives = 114/121 (94%), Gaps = 1/121 (0%)

Query: 1   MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
           MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY
Sbjct: 1   MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60

Query: 61  IRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGR-GREDGASGRQTKGIGRGLD 119
           +RGNTIKYLRVPDEVIDKVQEE KSR+DRKPPGVGR R R GR+D A GRQ KGIGRG+D
Sbjct: 61  VRGNTIKYLRVPDEVIDKVQEEAKSRTDRKPPGVGRARARGGRDDSAVGRQPKGIGRGMD 120

Query: 120 D 120
           D
Sbjct: 121 D 121




Binds specifically to the 3'-terminal U-tract of U6 snRNA.
Nicotiana tabacum (taxid: 4097)
>sp|Q9ZRU9|LSM4_FAGSY Probable U6 snRNA-associated Sm-like protein LSm4 OS=Fagus sylvatica GN=LSM4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LGE6|LSM4_ORYSJ Probable U6 snRNA-associated Sm-like protein LSm4 OS=Oryza sativa subsp. japonica GN=Os01g0256900 PE=2 SV=1 Back     alignment and function description
>sp|Q9QXA5|LSM4_MOUSE U6 snRNA-associated Sm-like protein LSm4 OS=Mus musculus GN=Lsm4 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y4Z0|LSM4_HUMAN U6 snRNA-associated Sm-like protein LSm4 OS=Homo sapiens GN=LSM4 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBK6|LSM4_BOVIN U6 snRNA-associated Sm-like protein LSm4 OS=Bos taurus GN=LSM4 PE=2 SV=1 Back     alignment and function description
>sp|Q54KX4|LSM4_DICDI Probable U6 snRNA-associated Sm-like protein LSm4 OS=Dictyostelium discoideum GN=lsm4 PE=3 SV=1 Back     alignment and function description
>sp|Q19952|LSM4_CAEEL Probable U6 snRNA-associated Sm-like protein LSm4 OS=Caenorhabditis elegans GN=lsm-4 PE=3 SV=1 Back     alignment and function description
>sp|O14352|LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsm4 PE=1 SV=1 Back     alignment and function description
>sp|P40070|LSM4_YEAST U6 snRNA-associated Sm-like protein LSm4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSM4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
12230258146 RecName: Full=Probable U6 snRNA-associat 0.8 0.821 0.909 4e-59
147768838 3804 hypothetical protein VITISV_023640 [Viti 0.793 0.031 0.957 4e-58
297743868196 unnamed protein product [Vitis vinifera] 0.8 0.612 0.958 2e-57
225437330150 PREDICTED: probable U6 snRNA-associated 0.8 0.8 0.958 6e-57
357511251150 U6 snRNA-associated Sm-like protein LSm4 0.793 0.793 0.942 4e-54
77745469147 glycine rich protein-like [Solanum tuber 0.8 0.816 0.868 1e-53
12230329148 RecName: Full=Probable U6 snRNA-associat 0.92 0.932 0.826 4e-53
449529475149 PREDICTED: probable U6 snRNA-associated 0.993 1.0 0.893 1e-52
296089694162 unnamed protein product [Vitis vinifera] 0.813 0.753 0.926 3e-52
449526219149 PREDICTED: probable U6 snRNA-associated 0.993 1.0 0.886 4e-52
>gi|12230258|sp|Q43582.1|LSM4_TOBAC RecName: Full=Probable U6 snRNA-associated Sm-like protein LSm4; AltName: Full=Glycine-rich protein 10; Short=GRP 10 gi|790473|emb|CAA58702.1| unnamed protein product [Nicotiana tabacum] Back     alignment and taxonomy information
 Score =  232 bits (592), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/121 (90%), Positives = 114/121 (94%), Gaps = 1/121 (0%)

Query: 1   MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
           MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY
Sbjct: 1   MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60

Query: 61  IRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGR-GREDGASGRQTKGIGRGLD 119
           +RGNTIKYLRVPDEVIDKVQEE KSR+DRKPPGVGR R R GR+D A GRQ KGIGRG+D
Sbjct: 61  VRGNTIKYLRVPDEVIDKVQEEAKSRTDRKPPGVGRARARGGRDDSAVGRQPKGIGRGMD 120

Query: 120 D 120
           D
Sbjct: 121 D 121




Source: Nicotiana tabacum

Species: Nicotiana tabacum

Genus: Nicotiana

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|147768838|emb|CAN75888.1| hypothetical protein VITISV_023640 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743868|emb|CBI36838.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225437330|ref|XP_002264738.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357511251|ref|XP_003625914.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|357516335|ref|XP_003628456.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|355500929|gb|AES82132.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|355522478|gb|AET02932.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] Back     alignment and taxonomy information
>gi|77745469|gb|ABB02633.1| glycine rich protein-like [Solanum tuberosum] gi|82623401|gb|ABB87115.1| glycine rich protein-like [Solanum tuberosum] Back     alignment and taxonomy information
>gi|12230329|sp|Q9ZRU9.1|LSM4_FAGSY RecName: Full=Probable U6 snRNA-associated Sm-like protein LSm4; AltName: Full=Glycine-rich protein 2 gi|3927916|emb|CAA10233.1| glycine-rich protein 2 [Fagus sylvatica] Back     alignment and taxonomy information
>gi|449529475|ref|XP_004171725.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296089694|emb|CBI39513.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449526219|ref|XP_004170111.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
TAIR|locus:2180295129 emb1644 "AT5G27720" [Arabidops 0.606 0.705 0.967 4.8e-46
FB|FBgn0032240154 CG17768 [Drosophila melanogast 0.58 0.564 0.839 9.9e-39
ZFIN|ZDB-GENE-040426-1652143 lsm4 "LSM4 homolog, U6 small n 0.573 0.601 0.837 4.3e-38
MGI|MGI:1354692137 Lsm4 "LSM4 homolog, U6 small n 0.613 0.671 0.793 5.5e-38
UNIPROTKB|Q3ZBK6139 LSM4 "U6 snRNA-associated Sm-l 0.573 0.618 0.825 8.9e-38
UNIPROTKB|Q9Y4Z0139 LSM4 "U6 snRNA-associated Sm-l 0.573 0.618 0.825 8.9e-38
ASPGD|ASPL0000001547119 AN10781 [Emericella nidulans ( 0.6 0.756 0.655 8.8e-31
DICTYBASE|DDB_G0287053177 lsm4 "putative U6 small nuclea 0.566 0.480 0.705 1.8e-30
WB|WBGene00003078123 lsm-4 [Caenorhabditis elegans 0.546 0.666 0.731 4.9e-30
POMBASE|SPBC30D10.06121 lsm4 "U6 snRNP-associated prot 0.593 0.735 0.633 5e-28
TAIR|locus:2180295 emb1644 "AT5G27720" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 483 (175.1 bits), Expect = 4.8e-46, P = 4.8e-46
 Identities = 89/92 (96%), Positives = 91/92 (98%)

Query:     1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
             MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY
Sbjct:     1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60

Query:    61 IRGNTIKYLRVPDEVIDKVQEETKSRSDRKPP 92
             IRGNTIKYLRVPDEVIDKVQEE K+R+DRKPP
Sbjct:    61 IRGNTIKYLRVPDEVIDKVQEE-KTRTDRKPP 91




GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0005732 "small nucleolar ribonucleoprotein complex" evidence=ISS
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
FB|FBgn0032240 CG17768 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1652 lsm4 "LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1354692 Lsm4 "LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZBK6 LSM4 "U6 snRNA-associated Sm-like protein LSm4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y4Z0 LSM4 "U6 snRNA-associated Sm-like protein LSm4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ASPGD|ASPL0000001547 AN10781 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287053 lsm4 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00003078 lsm-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPBC30D10.06 lsm4 "U6 snRNP-associated protein Lsm4 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9Y4Z0LSM4_HUMANNo assigned EC number0.82550.57330.6187yesno
Q9QXA5LSM4_MOUSENo assigned EC number0.75240.60.6569yesno
Q43582LSM4_TOBACNo assigned EC number0.90900.80.8219N/Ano
Q19952LSM4_CAEELNo assigned EC number0.72280.55330.6747yesno
Q9ZRU9LSM4_FAGSYNo assigned EC number0.82600.920.9324N/Ano
Q54KX4LSM4_DICDINo assigned EC number0.56390.80.6779yesno
Q9LGE6LSM4_ORYSJNo assigned EC number0.80830.68660.7006yesno
Q3ZBK6LSM4_BOVINNo assigned EC number0.82550.57330.6187yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
cd0172376 cd01723, LSm4, Like-Sm protein 4 2e-62
smart0065167 smart00651, Sm, snRNP Sm proteins 5e-24
cd0172170 cd01721, Sm_D3, Sm protein D3 4e-18
pfam0142366 pfam01423, LSM, LSM domain 2e-17
COG195879 COG1958, LSM1, Small nuclear ribonucleoprotein (sn 4e-17
cd0060063 cd00600, Sm_like, Sm and related proteins 4e-17
cd0172589 cd01725, LSm2, Like-Sm protein 2 9e-11
cd0173378 cd01733, LSm10, Like-Sm protein 10 4e-10
cd0172492 cd01724, Sm_D1, Sm protein D1 5e-09
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 3e-08
cd0172269 cd01722, Sm_F, Sm protein F 9e-07
cd0172668 cd01726, LSm6, Like-Sm protein 6 2e-06
pfam05918543 pfam05918, API5, Apoptosis inhibitory protein 5 (A 2e-04
PHA00370 297 PHA00370, III, attachment protein 2e-04
cd1167965 cd11679, archaeal_Sm_like, archaeal Sm-related pro 6e-04
PTZ00146 293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
>gnl|CDD|212470 cd01723, LSm4, Like-Sm protein 4 Back     alignment and domain information
 Score =  185 bits (473), Expect = 2e-62
 Identities = 69/76 (90%), Positives = 74/76 (97%)

Query: 2  LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYI 61
          LPLSLL+TAQGHP+LVELKNGETYNGHLVNCD WMNIHL+ VICTSKDGDRFW+MPECYI
Sbjct: 1  LPLSLLRTAQGHPVLVELKNGETYNGHLVNCDNWMNIHLKNVICTSKDGDRFWKMPECYI 60

Query: 62 RGNTIKYLRVPDEVID 77
          RGNTIKYLR+PDEVID
Sbjct: 61 RGNTIKYLRLPDEVID 76


The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 76

>gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins Back     alignment and domain information
>gnl|CDD|212468 cd01721, Sm_D3, Sm protein D3 Back     alignment and domain information
>gnl|CDD|201787 pfam01423, LSM, LSM domain Back     alignment and domain information
>gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins Back     alignment and domain information
>gnl|CDD|212472 cd01725, LSm2, Like-Sm protein 2 Back     alignment and domain information
>gnl|CDD|212480 cd01733, LSm10, Like-Sm protein 10 Back     alignment and domain information
>gnl|CDD|212471 cd01724, Sm_D1, Sm protein D1 Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|212469 cd01722, Sm_F, Sm protein F Back     alignment and domain information
>gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 Back     alignment and domain information
>gnl|CDD|218811 pfam05918, API5, Apoptosis inhibitory protein 5 (API5) Back     alignment and domain information
>gnl|CDD|164795 PHA00370, III, attachment protein Back     alignment and domain information
>gnl|CDD|212490 cd11679, archaeal_Sm_like, archaeal Sm-related protein Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
KOG3293134 consensus Small nuclear ribonucleoprotein (snRNP) 100.0
cd0172376 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins 99.95
cd0172490 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins 99.94
cd0172170 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins 99.93
cd0172581 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins 99.93
cd0173378 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins 99.91
cd0172667 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins 99.89
KOG3428109 consensus Small nuclear ribonucleoprotein SMD1 and 99.89
cd0172268 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins 99.88
PRK0073772 small nuclear ribonucleoprotein; Provisional 99.87
KOG3172119 consensus Small nuclear ribonucleoprotein Sm D3 [R 99.87
cd0173276 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins 99.87
cd0173168 archaeal_Sm1 The archaeal sm1 proteins: The Sm pro 99.86
COG195879 LSM1 Small nuclear ribonucleoprotein (snRNP) homol 99.83
smart0065167 Sm snRNP Sm proteins. small nuclear ribonucleoprot 99.83
PF0142367 LSM: LSM domain ; InterPro: IPR001163 This family 99.82
cd0171972 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins 99.81
KOG344896 consensus Predicted snRNP core protein [RNA proces 99.8
cd0173082 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins 99.79
cd0060063 Sm_like The eukaryotic Sm and Sm-like (LSm) protei 99.78
cd0172087 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins 99.78
KOG348279 consensus Small nuclear ribonucleoprotein (snRNP) 99.75
cd0172981 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins 99.75
cd0171879 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins 99.75
cd0171779 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins 99.69
cd0172874 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins 99.69
cd0172774 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins 99.68
KOG178377 consensus Small nuclear ribonucleoprotein F [RNA p 99.67
PTZ0013889 small nuclear ribonucleoprotein; Provisional 99.66
cd0616875 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins 99.61
KOG178077 consensus Small Nuclear ribonucleoprotein G [RNA p 99.52
KOG346091 consensus Small nuclear ribonucleoprotein (snRNP) 99.44
KOG177584 consensus U6 snRNA-associated Sm-like protein [RNA 99.4
KOG177488 consensus Small nuclear ribonucleoprotein E [RNA p 99.21
KOG1781108 consensus Small Nuclear ribonucleoprotein splicing 98.81
KOG3168177 consensus U1 snRNP component [Transcription] 98.75
KOG178496 consensus Small Nuclear ribonucleoprotein splicing 98.72
KOG1782129 consensus Small Nuclear ribonucleoprotein splicing 98.54
KOG3459114 consensus Small nuclear ribonucleoprotein (snRNP) 98.21
PF1443877 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. 97.96
cd0173966 LSm11_C The eukaryotic Sm and Sm-like (LSm) protei 97.59
PF1270196 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC 97.11
PF1109580 Gemin7: Gem-associated protein 7 (Gemin7); InterPr 97.01
KOG3262215 consensus H/ACA small nucleolar RNP component GAR1 96.88
cd0171661 Hfq Hfq, an abundant, ubiquitous RNA-binding prote 96.24
KOG3262215 consensus H/ACA small nucleolar RNP component GAR1 96.1
TIGR0238361 Hfq RNA chaperone Hfq. This model represents the R 96.09
PRK0039579 hfq RNA-binding protein Hfq; Provisional 95.74
cd0173674 LSm14_N LSm14 (also known as RAP55) belongs to a f 95.42
PF0223748 BPL_C: Biotin protein ligase C terminal domain; In 94.82
PF06372166 Gemin6: Gemin6 protein; InterPro: IPR009422 This f 94.76
KOG1073 361 consensus Uncharacterized mRNA-associated protein 94.01
COG192377 Hfq Uncharacterized host factor I protein [General 93.96
PF1084266 DUF2642: Protein of unknown function (DUF2642); In 92.52
PRK14091165 RNA-binding protein Hfq; Provisional 91.92
PRK14091165 RNA-binding protein Hfq; Provisional 91.11
cd0173561 LSm12_N LSm12 belongs to a family of Sm-like prote 89.56
PRK14639140 hypothetical protein; Provisional 87.42
PRK14638150 hypothetical protein; Provisional 86.9
PRK02001152 hypothetical protein; Validated 86.6
PRK14644136 hypothetical protein; Provisional 80.81
PTZ00034124 40S ribosomal protein S10; Provisional 80.53
KOG09211282 consensus Dosage compensation complex, subunit MLE 80.23
>KOG3293 consensus Small nuclear ribonucleoprotein (snRNP) [RNA processing and modification] Back     alignment and domain information
Probab=100.00  E-value=5.9e-35  Score=220.02  Aligned_cols=97  Identities=77%  Similarity=1.318  Sum_probs=89.6

Q ss_pred             CChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCccccchhH
Q 031975            1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQ   80 (150)
Q Consensus         1 MlPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd~ild~~~   80 (150)
                      |+||+||+.+++++|.||||||++|.|+|++||.||||+|++|+++++|+++|+.+++|||||++|+||.|||++||.++
T Consensus         1 mlPLsLL~~aq~~pmlvELKNget~nGhL~~cD~wMNl~L~~Vi~ts~Dgdkf~r~pEcYirGttIkylri~d~iid~vk   80 (134)
T KOG3293|consen    1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVNCDNWMNLHLREVICTSEDGDKFFRMPECYIRGTTIKYLRIPDEIIDKVK   80 (134)
T ss_pred             CcchhHHHhcCCCeEEEEecCCCEecceeecchhhhhcchheeEEeccCCCceeecceeEEecceeEEEeccHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhhhcCCCCCCCCCC
Q 031975           81 EETKSRSDRKPPGVGRG   97 (150)
Q Consensus        81 ~~~~~~~~~~~~~~~rg   97 (150)
                      +|..+..+.+...+.++
T Consensus        81 ee~~~~~~~r~~~r~~~   97 (134)
T KOG3293|consen   81 EECVSNNRNRKQSRDRG   97 (134)
T ss_pred             HHHHHhccchhcccccc
Confidence            99888766554333333



>cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3428 consensus Small nuclear ribonucleoprotein SMD1 and related snRNPs [RNA processing and modification] Back     alignment and domain information
>cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK00737 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>KOG3172 consensus Small nuclear ribonucleoprotein Sm D3 [RNA processing and modification] Back     alignment and domain information
>cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences Back     alignment and domain information
>COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] Back     alignment and domain information
>smart00651 Sm snRNP Sm proteins Back     alignment and domain information
>PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins Back     alignment and domain information
>cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3448 consensus Predicted snRNP core protein [RNA processing and modification] Back     alignment and domain information
>cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification] Back     alignment and domain information
>cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1783 consensus Small nuclear ribonucleoprotein F [RNA processing and modification] Back     alignment and domain information
>PTZ00138 small nuclear ribonucleoprotein; Provisional Back     alignment and domain information
>cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>KOG1780 consensus Small Nuclear ribonucleoprotein G [RNA processing and modification] Back     alignment and domain information
>KOG3460 consensus Small nuclear ribonucleoprotein (snRNP) LSM3 [RNA processing and modification] Back     alignment and domain information
>KOG1775 consensus U6 snRNA-associated Sm-like protein [RNA processing and modification] Back     alignment and domain information
>KOG1774 consensus Small nuclear ribonucleoprotein E [RNA processing and modification] Back     alignment and domain information
>KOG1781 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3168 consensus U1 snRNP component [Transcription] Back     alignment and domain information
>KOG1784 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1782 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG3459 consensus Small nuclear ribonucleoprotein (snRNP) Sm core protein [RNA processing and modification] Back     alignment and domain information
>PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 Back     alignment and domain information
>cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A Back     alignment and domain information
>PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins Back     alignment and domain information
>KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others Back     alignment and domain information
>KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02383 Hfq RNA chaperone Hfq Back     alignment and domain information
>PRK00395 hfq RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown Back     alignment and domain information
>PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins Back     alignment and domain information
>KOG1073 consensus Uncharacterized mRNA-associated protein RAP55 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] Back     alignment and domain information
>PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>PRK14091 RNA-binding protein Hfq; Provisional Back     alignment and domain information
>cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation Back     alignment and domain information
>PRK14639 hypothetical protein; Provisional Back     alignment and domain information
>PRK14638 hypothetical protein; Provisional Back     alignment and domain information
>PRK02001 hypothetical protein; Validated Back     alignment and domain information
>PRK14644 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00034 40S ribosomal protein S10; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
4emh_A105 Crystal Structure Of Splsm4 Length = 105 5e-29
3pgw_Z126 Crystal Structure Of Human U1 Snrnp Length = 126 5e-09
3cw1_D126 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 2e-08
1d3b_A75 Crystal Structure Of The D3b Subcomplex Of The Huma 3e-08
1b34_A119 Crystal Structure Of The D1d2 Sub-Complex From The 3e-05
3cw1_F86 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 5e-04
>pdb|4EMH|A Chain A, Crystal Structure Of Splsm4 Length = 105 Back     alignment and structure

Iteration: 1

Score = 122 bits (307), Expect = 5e-29, Method: Compositional matrix adjust. Identities = 55/89 (61%), Positives = 71/89 (79%), Gaps = 1/89 (1%) Query: 2 LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYI 61 LPL+LL QG P+LVELKNGET+NGHL NCD + N+ LREVI T DGD+F+R+PECYI Sbjct: 16 LPLTLLNATQGRPILVELKNGETFNGHLENCDNYXNLTLREVIRTXPDGDKFFRLPECYI 75 Query: 62 RGNTIKYLRVPDEVIDKV-QEETKSRSDR 89 RGN IKYLR+ DEV+ +V +++ + R +R Sbjct: 76 RGNNIKYLRIQDEVLSQVAKQQAQQRENR 104
>pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp Length = 126 Back     alignment and structure
>pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 126 Back     alignment and structure
>pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human Core Snrnp Domain At 2.0a Resolution Length = 75 Back     alignment and structure
>pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human Snrnp Core Domain Length = 119 Back     alignment and structure
>pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 86 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
1b34_A119 Protein (small nuclear ribonucleoprotein SM D1); s 100.0
2y9a_D126 Small nuclear ribonucleoprotein SM D3; splicing-RN 99.96
4emh_A105 Probable U6 snRNA-associated SM-like protein LSM4; 99.94
1d3b_A75 Protein (small nuclear ribonucleoprotein SM D3); s 99.94
1ljo_A77 Archaeal SM-like protein AF-SM2; snRNP, core snRNP 99.91
1i4k_A77 Putative snRNP SM-like protein; core snRNP domain, 99.9
3s6n_F86 Small nuclear ribonucleoprotein F; SMN complex, SM 99.89
1h64_175 SnRNP SM-like protein; SM fold, spliceosome, snRNP 99.89
4emk_B75 U6 snRNA-associated SM-like protein LSM6; SM fold, 99.88
1n9r_A93 SMF, small nuclear ribonucleoprotein F, snRNP-F, S 99.88
1th7_A81 SnRNP-2, small nuclear riboprotein protein; archae 99.88
1i8f_A81 Putative snRNP SM-like protein; beta barrel-like S 99.87
4emk_A94 U6 snRNA-associated SM-like protein LSM5; SM fold, 99.87
1mgq_A83 SM-like protein; LSM, RNA-binding, archea, RNA bin 99.86
3s6n_G76 Small nuclear ribonucleoprotein G; SMN complex, SM 99.85
3bw1_A96 SMX4 protein, U6 snRNA-associated SM-like protein 99.84
3s6n_E92 Small nuclear ribonucleoprotein E; SMN complex, SM 99.83
2fwk_A121 U6 snRNA-associated SM-like protein LSM5; structur 99.83
1m5q_A130 SMAP3, small nuclear ribonucleoprotein homolog, SM 99.82
1d3b_B91 Protein (small nuclear ribonucleoprotein associat 99.81
4emg_A93 Probable U6 snRNA-associated SM-like protein LSM3; 99.81
1b34_B118 Protein (small nuclear ribonucleoprotein SM D2); s 99.79
4emk_C113 U6 snRNA-associated SM-like protein LSM7; SM fold, 99.78
3pgw_B231 SM B; protein-RNA complex, U1 snRNA, SM fold, SM c 99.75
1y96_A86 Gemin6, SIP2, GEM-associated protein 6; SM fold, p 98.87
1y96_B85 Gemin7, SIP3, GEM-associated protein 7; SM fold, p 96.93
2vxe_A88 CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA 96.64
2ylb_A74 Protein HFQ; RNA-binding protein, LSM protein, RNA 96.6
3ahu_A78 Protein HFQ; SM-like motif, protein-RNA complex, t 96.49
1kq1_A77 HFQ, HOST factor for Q beta; hexamer, RNA binding 96.43
2fb7_A95 SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 96.34
4a53_A125 EDC3; RNA binding protein; NMR {Schizosaccharomyce 96.25
3sb2_A79 Protein HFQ; SM-like, RNA chaperone, chaperone; 2. 96.24
1u1s_A82 HFQ protein; SM-like bacterial protein, riken stru 96.22
2y90_A104 Protein HFQ; RNA-binding protein, SM-like, RNA cha 95.95
2qtx_A71 Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi 95.65
2vc8_A84 Enhancer of mRNA-decapping protein 3; P-BODY compo 95.39
3hfo_A70 SSR3341 protein; HFQ, SM, RNA-binding protein, sRN 94.8
3hfn_A72 ASL2047 protein; HFQ, SM, RNA-binding protein, sRN 93.07
1ycy_A71 Conserved hypothetical protein; structural genomic 91.44
2rm4_A103 CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- 87.29
>1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Back     alignment and structure
Probab=100.00  E-value=5.8e-34  Score=212.34  Aligned_cols=89  Identities=29%  Similarity=0.487  Sum_probs=74.5

Q ss_pred             CChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCccc-cchh
Q 031975            1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEV-IDKV   79 (150)
Q Consensus         1 MlPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd~i-ld~~   79 (150)
                      |+|++||+++++++|+|+|+|+++|+|+|.+||+||||+|+||+|+..++++ .+++++||||+||+||++||++ +|.+
T Consensus         1 M~p~~~L~~~~gk~V~V~Lk~g~~~~G~L~~~D~~MNlvL~d~~e~~~~~~~-~~lg~v~IRG~nI~~I~~pd~l~~d~~   79 (119)
T 1b34_A            1 MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREP-VQLETLSIRGNNIRYFILPDSLPLDTL   79 (119)
T ss_dssp             -CHHHHHHTCTTCEEEEEETTCCEEEEEEEEECTTCCEEEEEEEEECTTSCC-EEEEEEEECGGGEEEEECCTTCCHHHH
T ss_pred             CChHHHHHHhCCCEEEEEEcCCCEEEEEEEEEcccceEEeccEEEecCCCce-eEcceEEEcCCeEEEEEeccccccchh
Confidence            9999999999999999999999999999999999999999999999766654 6899999999999999999998 7877


Q ss_pred             HHHhhhhcCCC
Q 031975           80 QEETKSRSDRK   90 (150)
Q Consensus        80 ~~~~~~~~~~~   90 (150)
                      +.++.++++.+
T Consensus        80 l~~~~pK~k~~   90 (119)
T 1b34_A           80 LVDVEPKVKSK   90 (119)
T ss_dssp             TC---------
T ss_pred             Hhhhccccccc
Confidence            77766654433



>2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Back     alignment and structure
>4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Back     alignment and structure
>1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Back     alignment and structure
>1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Back     alignment and structure
>3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Back     alignment and structure
>1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Back     alignment and structure
>4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Back     alignment and structure
>1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Back     alignment and structure
>1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Back     alignment and structure
>1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Back     alignment and structure
>4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Back     alignment and structure
>1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Back     alignment and structure
>3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Back     alignment and structure
>3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Back     alignment and structure
>2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Back     alignment and structure
>1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 Back     alignment and structure
>1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Back     alignment and structure
>4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Back     alignment and structure
>1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Back     alignment and structure
>4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Back     alignment and structure
>3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Back     alignment and structure
>1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* Back     alignment and structure
>3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A Back     alignment and structure
>1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A Back     alignment and structure
>2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A Back     alignment and structure
>4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A Back     alignment and structure
>3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 Back     alignment and structure
>1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A Back     alignment and structure
>2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A Back     alignment and structure
>2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} Back     alignment and structure
>3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} Back     alignment and structure
>3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} Back     alignment and structure
>1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 Back     alignment and structure
>2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1m5q1_127 b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch 1e-29
d1b34a_80 b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s 2e-26
d1d3ba_72 b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s 3e-26
d1mgqa_74 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-21
d1i4k1_72 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 4e-21
d1ljoa_75 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 1e-20
d1h641_71 b.38.1.1 (1:) Archaeal homoheptameric Sm protein { 2e-20
d1th7a176 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote 3e-20
d1n9ra_68 b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S 2e-19
d1i8fa_71 b.38.1.1 (A:) Archaeal homoheptameric Sm protein { 2e-18
d2fwka192 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr 2e-15
d1d3bb_81 b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa 5e-04
d1b34b_93 b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s 0.004
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: Sm-Like archaeal protein Smap3
species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
 Score =  102 bits (256), Expect = 1e-29
 Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 7/90 (7%)

Query: 4  LSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRG 63
          ++ L    G  + V L NGE Y G L   D  +NI L      + +     +    +I  
Sbjct: 2  VAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGE-----KFNRVFIMY 56

Query: 64 NTIKYLRVPDEVIDKVQEETKSRSDRKPPG 93
            I ++   +  ID    E   ++++  PG
Sbjct: 57 RYIVHIDSTERRID--MREFAKQAEKIFPG 84


>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1d3ba_72 D3 core SNRNP protein {Human (Homo sapiens) [TaxId 99.94
d1b34a_80 D1 core SNRNP protein {Human (Homo sapiens) [TaxId 99.93
d1ljoa_75 Archaeal homoheptameric Sm protein {Archaeon Archa 99.88
d1i4k1_72 Archaeal homoheptameric Sm protein {Archaeon Archa 99.88
d1h641_71 Archaeal homoheptameric Sm protein {Archaeon Pyroc 99.87
d1mgqa_74 Archaeal homoheptameric Sm protein {Archaeon Metha 99.87
d1n9ra_68 Small nuclear ribonucleoprotein F, Smf {Baker's ye 99.86
d1m5q1_127 Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul 99.85
d1th7a176 Archaeal homoheptameric Sm protein {Sulfolobus sol 99.85
d1i8fa_71 Archaeal homoheptameric Sm protein {Archaeon Pyrob 99.85
d2fwka192 U6 snRNA-associated sm-like protein LSM5 {Cryptosp 99.81
d1b34b_93 D2 core SNRNP protein {Human (Homo sapiens) [TaxId 99.71
d1d3bb_81 B core SNRNP protein {Human (Homo sapiens) [TaxId: 99.67
d2vxfa180 LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) 96.69
d1kq1a_60 Pleiotropic translational regulator Hfq {Staphyloc 95.88
d1u1sa166 Pleiotropic translational regulator Hfq {Pseudomon 95.41
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-t 93.09
d1ycya166 Hypothetical protein PF1955 {Pyrococcus furiosus [ 91.08
>d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Sm-like fold
superfamily: Sm-like ribonucleoproteins
family: Sm motif of small nuclear ribonucleoproteins, SNRNP
domain: D3 core SNRNP protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=7.4e-27  Score=158.45  Aligned_cols=71  Identities=34%  Similarity=0.690  Sum_probs=68.1

Q ss_pred             ChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCc
Q 031975            2 LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPD   73 (150)
Q Consensus         2 lPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd   73 (150)
                      +|+.||++++|++|+|||||+++|+|+|.+||.||||+|+||+++..++++ ++++++||||++|+||++||
T Consensus         2 ~Pl~~L~~~~g~~V~VeLkng~~~~G~L~~~D~~mNi~L~~~~~~~~~~~~-~~~~~v~IRG~~I~~i~lpd   72 (72)
T d1d3ba_           2 VPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRV-AQLEQVYIRGCKIRFLILPD   72 (72)
T ss_dssp             CHHHHHHHTTTSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEECTTSCE-EEEEEEEECGGGEEEEEECC
T ss_pred             CchHHHHhcCCCEEEEEECCCeEEEEEEEEEcCCeeEEEEEEEEEcCCCcE-eEcCeEEEECCEEEEEEcCC
Confidence            699999999999999999999999999999999999999999999888775 68999999999999999997



>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Back     information, alignment and structure
>d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Back     information, alignment and structure
>d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure