Citrus Sinensis ID: 031975
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| 12230258 | 146 | RecName: Full=Probable U6 snRNA-associat | 0.8 | 0.821 | 0.909 | 4e-59 | |
| 147768838 | 3804 | hypothetical protein VITISV_023640 [Viti | 0.793 | 0.031 | 0.957 | 4e-58 | |
| 297743868 | 196 | unnamed protein product [Vitis vinifera] | 0.8 | 0.612 | 0.958 | 2e-57 | |
| 225437330 | 150 | PREDICTED: probable U6 snRNA-associated | 0.8 | 0.8 | 0.958 | 6e-57 | |
| 357511251 | 150 | U6 snRNA-associated Sm-like protein LSm4 | 0.793 | 0.793 | 0.942 | 4e-54 | |
| 77745469 | 147 | glycine rich protein-like [Solanum tuber | 0.8 | 0.816 | 0.868 | 1e-53 | |
| 12230329 | 148 | RecName: Full=Probable U6 snRNA-associat | 0.92 | 0.932 | 0.826 | 4e-53 | |
| 449529475 | 149 | PREDICTED: probable U6 snRNA-associated | 0.993 | 1.0 | 0.893 | 1e-52 | |
| 296089694 | 162 | unnamed protein product [Vitis vinifera] | 0.813 | 0.753 | 0.926 | 3e-52 | |
| 449526219 | 149 | PREDICTED: probable U6 snRNA-associated | 0.993 | 1.0 | 0.886 | 4e-52 |
| >gi|12230258|sp|Q43582.1|LSM4_TOBAC RecName: Full=Probable U6 snRNA-associated Sm-like protein LSm4; AltName: Full=Glycine-rich protein 10; Short=GRP 10 gi|790473|emb|CAA58702.1| unnamed protein product [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
Score = 232 bits (592), Expect = 4e-59, Method: Compositional matrix adjust.
Identities = 110/121 (90%), Positives = 114/121 (94%), Gaps = 1/121 (0%)
Query: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY
Sbjct: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
Query: 61 IRGNTIKYLRVPDEVIDKVQEETKSRSDRKPPGVGRGRGR-GREDGASGRQTKGIGRGLD 119
+RGNTIKYLRVPDEVIDKVQEE KSR+DRKPPGVGR R R GR+D A GRQ KGIGRG+D
Sbjct: 61 VRGNTIKYLRVPDEVIDKVQEEAKSRTDRKPPGVGRARARGGRDDSAVGRQPKGIGRGMD 120
Query: 120 D 120
D
Sbjct: 121 D 121
|
Source: Nicotiana tabacum Species: Nicotiana tabacum Genus: Nicotiana Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147768838|emb|CAN75888.1| hypothetical protein VITISV_023640 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297743868|emb|CBI36838.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225437330|ref|XP_002264738.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357511251|ref|XP_003625914.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|357516335|ref|XP_003628456.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|355500929|gb|AES82132.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] gi|355522478|gb|AET02932.1| U6 snRNA-associated Sm-like protein LSm4 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|77745469|gb|ABB02633.1| glycine rich protein-like [Solanum tuberosum] gi|82623401|gb|ABB87115.1| glycine rich protein-like [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|12230329|sp|Q9ZRU9.1|LSM4_FAGSY RecName: Full=Probable U6 snRNA-associated Sm-like protein LSm4; AltName: Full=Glycine-rich protein 2 gi|3927916|emb|CAA10233.1| glycine-rich protein 2 [Fagus sylvatica] | Back alignment and taxonomy information |
|---|
| >gi|449529475|ref|XP_004171725.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296089694|emb|CBI39513.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449526219|ref|XP_004170111.1| PREDICTED: probable U6 snRNA-associated Sm-like protein LSm4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 150 | ||||||
| TAIR|locus:2180295 | 129 | emb1644 "AT5G27720" [Arabidops | 0.606 | 0.705 | 0.967 | 4.8e-46 | |
| FB|FBgn0032240 | 154 | CG17768 [Drosophila melanogast | 0.58 | 0.564 | 0.839 | 9.9e-39 | |
| ZFIN|ZDB-GENE-040426-1652 | 143 | lsm4 "LSM4 homolog, U6 small n | 0.573 | 0.601 | 0.837 | 4.3e-38 | |
| MGI|MGI:1354692 | 137 | Lsm4 "LSM4 homolog, U6 small n | 0.613 | 0.671 | 0.793 | 5.5e-38 | |
| UNIPROTKB|Q3ZBK6 | 139 | LSM4 "U6 snRNA-associated Sm-l | 0.573 | 0.618 | 0.825 | 8.9e-38 | |
| UNIPROTKB|Q9Y4Z0 | 139 | LSM4 "U6 snRNA-associated Sm-l | 0.573 | 0.618 | 0.825 | 8.9e-38 | |
| ASPGD|ASPL0000001547 | 119 | AN10781 [Emericella nidulans ( | 0.6 | 0.756 | 0.655 | 8.8e-31 | |
| DICTYBASE|DDB_G0287053 | 177 | lsm4 "putative U6 small nuclea | 0.566 | 0.480 | 0.705 | 1.8e-30 | |
| WB|WBGene00003078 | 123 | lsm-4 [Caenorhabditis elegans | 0.546 | 0.666 | 0.731 | 4.9e-30 | |
| POMBASE|SPBC30D10.06 | 121 | lsm4 "U6 snRNP-associated prot | 0.593 | 0.735 | 0.633 | 5e-28 |
| TAIR|locus:2180295 emb1644 "AT5G27720" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 483 (175.1 bits), Expect = 4.8e-46, P = 4.8e-46
Identities = 89/92 (96%), Positives = 91/92 (98%)
Query: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY
Sbjct: 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECY 60
Query: 61 IRGNTIKYLRVPDEVIDKVQEETKSRSDRKPP 92
IRGNTIKYLRVPDEVIDKVQEE K+R+DRKPP
Sbjct: 61 IRGNTIKYLRVPDEVIDKVQEE-KTRTDRKPP 91
|
|
| FB|FBgn0032240 CG17768 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1652 lsm4 "LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1354692 Lsm4 "LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3ZBK6 LSM4 "U6 snRNA-associated Sm-like protein LSm4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4Z0 LSM4 "U6 snRNA-associated Sm-like protein LSm4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000001547 AN10781 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0287053 lsm4 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003078 lsm-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC30D10.06 lsm4 "U6 snRNP-associated protein Lsm4 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 150 | |||
| cd01723 | 76 | cd01723, LSm4, Like-Sm protein 4 | 2e-62 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 5e-24 | |
| cd01721 | 70 | cd01721, Sm_D3, Sm protein D3 | 4e-18 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 2e-17 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 4e-17 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 4e-17 | |
| cd01725 | 89 | cd01725, LSm2, Like-Sm protein 2 | 9e-11 | |
| cd01733 | 78 | cd01733, LSm10, Like-Sm protein 10 | 4e-10 | |
| cd01724 | 92 | cd01724, Sm_D1, Sm protein D1 | 5e-09 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 3e-08 | |
| cd01722 | 69 | cd01722, Sm_F, Sm protein F | 9e-07 | |
| cd01726 | 68 | cd01726, LSm6, Like-Sm protein 6 | 2e-06 | |
| pfam05918 | 543 | pfam05918, API5, Apoptosis inhibitory protein 5 (A | 2e-04 | |
| PHA00370 | 297 | PHA00370, III, attachment protein | 2e-04 | |
| cd11679 | 65 | cd11679, archaeal_Sm_like, archaeal Sm-related pro | 6e-04 | |
| PTZ00146 | 293 | PTZ00146, PTZ00146, fibrillarin; Provisional | 0.001 |
| >gnl|CDD|212470 cd01723, LSm4, Like-Sm protein 4 | Back alignment and domain information |
|---|
Score = 185 bits (473), Expect = 2e-62
Identities = 69/76 (90%), Positives = 74/76 (97%)
Query: 2 LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYI 61
LPLSLL+TAQGHP+LVELKNGETYNGHLVNCD WMNIHL+ VICTSKDGDRFW+MPECYI
Sbjct: 1 LPLSLLRTAQGHPVLVELKNGETYNGHLVNCDNWMNIHLKNVICTSKDGDRFWKMPECYI 60
Query: 62 RGNTIKYLRVPDEVID 77
RGNTIKYLR+PDEVID
Sbjct: 61 RGNTIKYLRLPDEVID 76
|
The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 76 |
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212468 cd01721, Sm_D3, Sm protein D3 | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212472 cd01725, LSm2, Like-Sm protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212480 cd01733, LSm10, Like-Sm protein 10 | Back alignment and domain information |
|---|
| >gnl|CDD|212471 cd01724, Sm_D1, Sm protein D1 | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212469 cd01722, Sm_F, Sm protein F | Back alignment and domain information |
|---|
| >gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|218811 pfam05918, API5, Apoptosis inhibitory protein 5 (API5) | Back alignment and domain information |
|---|
| >gnl|CDD|164795 PHA00370, III, attachment protein | Back alignment and domain information |
|---|
| >gnl|CDD|212490 cd11679, archaeal_Sm_like, archaeal Sm-related protein | Back alignment and domain information |
|---|
| >gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| KOG3293 | 134 | consensus Small nuclear ribonucleoprotein (snRNP) | 100.0 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.95 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.94 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.93 | |
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.93 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.91 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| KOG3428 | 109 | consensus Small nuclear ribonucleoprotein SMD1 and | 99.89 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.88 | |
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.87 | |
| KOG3172 | 119 | consensus Small nuclear ribonucleoprotein Sm D3 [R | 99.87 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.87 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.86 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.83 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.83 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.82 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.81 | |
| KOG3448 | 96 | consensus Predicted snRNP core protein [RNA proces | 99.8 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.79 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.78 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.78 | |
| KOG3482 | 79 | consensus Small nuclear ribonucleoprotein (snRNP) | 99.75 | |
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.75 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.75 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.69 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.69 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.68 | |
| KOG1783 | 77 | consensus Small nuclear ribonucleoprotein F [RNA p | 99.67 | |
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.66 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.61 | |
| KOG1780 | 77 | consensus Small Nuclear ribonucleoprotein G [RNA p | 99.52 | |
| KOG3460 | 91 | consensus Small nuclear ribonucleoprotein (snRNP) | 99.44 | |
| KOG1775 | 84 | consensus U6 snRNA-associated Sm-like protein [RNA | 99.4 | |
| KOG1774 | 88 | consensus Small nuclear ribonucleoprotein E [RNA p | 99.21 | |
| KOG1781 | 108 | consensus Small Nuclear ribonucleoprotein splicing | 98.81 | |
| KOG3168 | 177 | consensus U1 snRNP component [Transcription] | 98.75 | |
| KOG1784 | 96 | consensus Small Nuclear ribonucleoprotein splicing | 98.72 | |
| KOG1782 | 129 | consensus Small Nuclear ribonucleoprotein splicing | 98.54 | |
| KOG3459 | 114 | consensus Small nuclear ribonucleoprotein (snRNP) | 98.21 | |
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 97.96 | |
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 97.59 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 97.11 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 97.01 | |
| KOG3262 | 215 | consensus H/ACA small nucleolar RNP component GAR1 | 96.88 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 96.24 | |
| KOG3262 | 215 | consensus H/ACA small nucleolar RNP component GAR1 | 96.1 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 96.09 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 95.74 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 95.42 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 94.82 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 94.76 | |
| KOG1073 | 361 | consensus Uncharacterized mRNA-associated protein | 94.01 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 93.96 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 92.52 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 91.92 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 91.11 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 89.56 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 87.42 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 86.9 | |
| PRK02001 | 152 | hypothetical protein; Validated | 86.6 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 80.81 | |
| PTZ00034 | 124 | 40S ribosomal protein S10; Provisional | 80.53 | |
| KOG0921 | 1282 | consensus Dosage compensation complex, subunit MLE | 80.23 |
| >KOG3293 consensus Small nuclear ribonucleoprotein (snRNP) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.9e-35 Score=220.02 Aligned_cols=97 Identities=77% Similarity=1.318 Sum_probs=89.6
Q ss_pred CChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCccccchhH
Q 031975 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQ 80 (150)
Q Consensus 1 MlPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd~ild~~~ 80 (150)
|+||+||+.+++++|.||||||++|.|+|++||.||||+|++|+++++|+++|+.+++|||||++|+||.|||++||.++
T Consensus 1 mlPLsLL~~aq~~pmlvELKNget~nGhL~~cD~wMNl~L~~Vi~ts~Dgdkf~r~pEcYirGttIkylri~d~iid~vk 80 (134)
T KOG3293|consen 1 MLPLSLLKTAQNHPMLVELKNGETYNGHLVNCDNWMNLHLREVICTSEDGDKFFRMPECYIRGTTIKYLRIPDEIIDKVK 80 (134)
T ss_pred CcchhHHHhcCCCeEEEEecCCCEecceeecchhhhhcchheeEEeccCCCceeecceeEEecceeEEEeccHHHHHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhhcCCCCCCCCCC
Q 031975 81 EETKSRSDRKPPGVGRG 97 (150)
Q Consensus 81 ~~~~~~~~~~~~~~~rg 97 (150)
+|..+..+.+...+.++
T Consensus 81 ee~~~~~~~r~~~r~~~ 97 (134)
T KOG3293|consen 81 EECVSNNRNRKQSRDRG 97 (134)
T ss_pred HHHHHhccchhcccccc
Confidence 99888766554333333
|
|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3428 consensus Small nuclear ribonucleoprotein SMD1 and related snRNPs [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >KOG3172 consensus Small nuclear ribonucleoprotein Sm D3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3448 consensus Predicted snRNP core protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3482 consensus Small nuclear ribonucleoprotein (snRNP) SMF [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1783 consensus Small nuclear ribonucleoprotein F [RNA processing and modification] | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1780 consensus Small Nuclear ribonucleoprotein G [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3460 consensus Small nuclear ribonucleoprotein (snRNP) LSM3 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1775 consensus U6 snRNA-associated Sm-like protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1774 consensus Small nuclear ribonucleoprotein E [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1781 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3168 consensus U1 snRNP component [Transcription] | Back alignment and domain information |
|---|
| >KOG1784 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1782 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3459 consensus Small nuclear ribonucleoprotein (snRNP) Sm core protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >KOG3262 consensus H/ACA small nucleolar RNP component GAR1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >KOG1073 consensus Uncharacterized mRNA-associated protein RAP55 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00034 40S ribosomal protein S10; Provisional | Back alignment and domain information |
|---|
| >KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 150 | ||||
| 4emh_A | 105 | Crystal Structure Of Splsm4 Length = 105 | 5e-29 | ||
| 3pgw_Z | 126 | Crystal Structure Of Human U1 Snrnp Length = 126 | 5e-09 | ||
| 3cw1_D | 126 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 2e-08 | ||
| 1d3b_A | 75 | Crystal Structure Of The D3b Subcomplex Of The Huma | 3e-08 | ||
| 1b34_A | 119 | Crystal Structure Of The D1d2 Sub-Complex From The | 3e-05 | ||
| 3cw1_F | 86 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 5e-04 |
| >pdb|4EMH|A Chain A, Crystal Structure Of Splsm4 Length = 105 | Back alignment and structure |
|
| >pdb|3PGW|Z Chain Z, Crystal Structure Of Human U1 Snrnp Length = 126 | Back alignment and structure |
| >pdb|3CW1|D Chain D, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 126 | Back alignment and structure |
| >pdb|1D3B|A Chain A, Crystal Structure Of The D3b Subcomplex Of The Human Core Snrnp Domain At 2.0a Resolution Length = 75 | Back alignment and structure |
| >pdb|1B34|A Chain A, Crystal Structure Of The D1d2 Sub-Complex From The Human Snrnp Core Domain Length = 119 | Back alignment and structure |
| >pdb|3CW1|F Chain F, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 86 | Back alignment and structure |
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 100.0 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.96 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.94 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.94 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.91 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.9 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.89 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.89 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.88 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.88 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.88 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.87 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.87 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.86 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.85 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.84 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.83 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.83 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.82 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.81 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.81 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.79 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.78 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.75 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 98.87 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 96.93 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 96.64 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 96.6 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 96.49 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 96.43 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 96.34 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 96.25 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.24 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 96.22 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 95.95 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 95.65 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 95.39 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 94.8 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 93.07 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 91.44 | |
| 2rm4_A | 103 | CG6311-PB, DM EDC3; enhancer of mRNA decapping, P- | 87.29 |
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.8e-34 Score=212.34 Aligned_cols=89 Identities=29% Similarity=0.487 Sum_probs=74.5
Q ss_pred CChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCccc-cchh
Q 031975 1 MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEV-IDKV 79 (150)
Q Consensus 1 MlPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd~i-ld~~ 79 (150)
|+|++||+++++++|+|+|+|+++|+|+|.+||+||||+|+||+|+..++++ .+++++||||+||+||++||++ +|.+
T Consensus 1 M~p~~~L~~~~gk~V~V~Lk~g~~~~G~L~~~D~~MNlvL~d~~e~~~~~~~-~~lg~v~IRG~nI~~I~~pd~l~~d~~ 79 (119)
T 1b34_A 1 MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREP-VQLETLSIRGNNIRYFILPDSLPLDTL 79 (119)
T ss_dssp -CHHHHHHTCTTCEEEEEETTCCEEEEEEEEECTTCCEEEEEEEEECTTSCC-EEEEEEEECGGGEEEEECCTTCCHHHH
T ss_pred CChHHHHHHhCCCEEEEEEcCCCEEEEEEEEEcccceEEeccEEEecCCCce-eEcceEEEcCCeEEEEEeccccccchh
Confidence 9999999999999999999999999999999999999999999999766654 6899999999999999999998 7877
Q ss_pred HHHhhhhcCCC
Q 031975 80 QEETKSRSDRK 90 (150)
Q Consensus 80 ~~~~~~~~~~~ 90 (150)
+.++.++++.+
T Consensus 80 l~~~~pK~k~~ 90 (119)
T 1b34_A 80 LVDVEPKVKSK 90 (119)
T ss_dssp TC---------
T ss_pred Hhhhccccccc
Confidence 77766654433
|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >2rm4_A CG6311-PB, DM EDC3; enhancer of mRNA decapping, P-BODY component, SM-like protein,, protein binding; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 150 | ||||
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 1e-29 | |
| d1b34a_ | 80 | b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s | 2e-26 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 3e-26 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-21 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 4e-21 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 1e-20 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 2e-20 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 3e-20 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 2e-19 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-18 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 2e-15 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 5e-04 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 0.004 |
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Sm-Like archaeal protein Smap3 species: Archaeon Pyrobaculum aerophilum [TaxId: 13773]
Score = 102 bits (256), Expect = 1e-29
Identities = 21/90 (23%), Positives = 36/90 (40%), Gaps = 7/90 (7%)
Query: 4 LSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRG 63
++ L G + V L NGE Y G L D +NI L + + + +I
Sbjct: 2 VAELNNLLGREVQVVLSNGEVYKGVLHAVDNQLNIVLANASNKAGE-----KFNRVFIMY 56
Query: 64 NTIKYLRVPDEVIDKVQEETKSRSDRKPPG 93
I ++ + ID E ++++ PG
Sbjct: 57 RYIVHIDSTERRID--MREFAKQAEKIFPG 84
|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 150 | |||
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.94 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.93 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.88 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.88 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.87 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.87 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.86 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.85 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.85 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.85 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.81 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.71 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.67 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 96.69 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 95.88 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 95.41 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 93.09 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 91.08 |
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: D3 core SNRNP protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94 E-value=7.4e-27 Score=158.45 Aligned_cols=71 Identities=34% Similarity=0.690 Sum_probs=68.1
Q ss_pred ChHHHHhhcCCCcEEEEEcCCcEEEEEEEEecCccceEEccEEEEccCCCeeeecCeEEEecCeEEEEecCc
Q 031975 2 LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPD 73 (150)
Q Consensus 2 lPl~lL~~l~gk~V~VeLKnG~~~~G~L~~vD~~MNl~L~dv~et~~dg~~~~~l~~v~IRG~nIryI~lpd 73 (150)
+|+.||++++|++|+|||||+++|+|+|.+||.||||+|+||+++..++++ ++++++||||++|+||++||
T Consensus 2 ~Pl~~L~~~~g~~V~VeLkng~~~~G~L~~~D~~mNi~L~~~~~~~~~~~~-~~~~~v~IRG~~I~~i~lpd 72 (72)
T d1d3ba_ 2 VPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRV-AQLEQVYIRGCKIRFLILPD 72 (72)
T ss_dssp CHHHHHHHTTTSEEEEEETTSCEEEEEEEEECTTCCEEEEEEEEECTTSCE-EEEEEEEECGGGEEEEEECC
T ss_pred CchHHHHhcCCCEEEEEECCCeEEEEEEEEEcCCeeEEEEEEEEEcCCCcE-eEcCeEEEECCEEEEEEcCC
Confidence 699999999999999999999999999999999999999999999888775 68999999999999999997
|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|