Citrus Sinensis ID: 031982

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MAASQASLLLQKQLKDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSSPNDESPANVEAAVSYLWVP
ccHHHHHHHHHHHHHHHHccccccEEEEEccccccCEEEEEEEccccccccccEEEEEEEcccccccccccEEECcccccccccccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHcc
*****AS*LLQKQLKDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSSPNDESPANVEAAVSYLWV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASQASLLLQKQLKDLCKNPVAGFSAGLVDETNIFEWSVTIIGPPDTLYEGGFFNAIMSFPSNYPNSPPTVKFTTEIWHPNVYPDGRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSSPNDESPANVEAAVSYLWVP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 7 Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains, and of the HRD1 ubiquitin ligase complex, which is part of the ERAD-L and ERAD-M pathways responsible for the rapid degradation of soluble lumenal and membrane proteins with misfolded lumenal domains (ERAD-L), or ER-membrane proteins with misfolded transmembrane domains (ERAD-M). Involved in resistance to cadmium poisoning.probableQ02159
Ubiquitin-conjugating enzyme E2 G1 Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. May be involved in degradation of muscle-specific proteins. Mediates polyubiquitination of CYP3A4.probableP62253
Probable ubiquitin-conjugating enzyme E2 7 Catalyzes the covalent attachment of ubiquitin to other proteins.probableP34477

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2UCZ, chain A
Confidence level:very confident
Coverage over the Query: 2-148
View the alignment between query and template
View the model in PyMOL