Citrus Sinensis ID: 032008

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MADALTEDQIAEFQEAFCMIDKDSDGLITMKDLATVIQSAQDEHPRKEEVQEMISEVDFDGNGSIDFLEFLTIMGRKMKENVSEELKEAFKVFDRDQDGFISAAELRNVMMNLGERLSDEETEQMIREADLDGDGLVSFEEFARMMMAF
ccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccccCEEHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHcc
**DALTEDQIAEFQEAFCMIDKDSDGLITMKDLATVIQSAQDEHPRKEEVQEMISEVDFDGNGSIDFLEFLTIMGRKMKENV*EELKEAFKVFDRDQDGFISAAELRNVMMNLGERLSDEETEQMIREADLDGDGLVSFEEFARMMMAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADALTEDQIAEFQEAFCMIDKDSDGLITMKDLATVIQSAQDEHPRKEEVQEMISEVDFDGNGSIDFLEFLTIMGRKMKENVSEELKEAFKVFDRDQDGFISxxxxxxxxxxxxxxxxxxxxxQMIREADLDGDGLVSFEEFARMMMAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin-5 Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.probableQ682T9
Calmodulin-3 Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.probableP0DH98
Calmodulin-1 Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases.probableP0DH95

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SG6, chain A
Confidence level:very confident
Coverage over the Query: 4-147
View the alignment between query and template
View the model in PyMOL