Query         032009
Match_columns 149
No_of_seqs    143 out of 897
Neff          5.9 
Searched_HMMs 46136
Date          Fri Mar 29 08:21:45 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032009.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032009hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0944 Ubiquitin-specific pro  99.9 1.9E-25   4E-30  201.2   6.4  109   20-137   145-267 (763)
  2 PF02148 zf-UBP:  Zn-finger in   99.9 1.2E-23 2.6E-28  139.5   5.8   61   55-115     1-62  (63)
  3 COG5207 UBP14 Isopeptidase T [  99.9 2.2E-22 4.8E-27  178.0   3.5  108   24-137   145-263 (749)
  4 KOG0804 Cytoplasmic Zn-finger   99.7 1.1E-18 2.3E-23  152.1   3.3   64   51-114   227-290 (493)
  5 cd02669 Peptidase_C19M A subfa  99.6 3.5E-16 7.6E-21  136.7   6.0   69   51-119    15-83  (440)
  6 smart00290 ZnF_UBP Ubiquitin C  99.6 4.3E-15 9.4E-20   93.4   4.2   49   54-102     1-49  (50)
  7 KOG1873 Ubiquitin-specific pro  99.5 3.6E-15 7.9E-20  136.4   1.8   79   32-110    43-143 (877)
  8 KOG2026 Spindle pole body prot  96.2  0.0045 9.8E-08   54.4   3.4   67   51-117    28-95  (442)
  9 COG5207 UBP14 Isopeptidase T [  95.5  0.0023   5E-08   58.2  -1.3   69   32-101     1-76  (749)
 10 KOG0944 Ubiquitin-specific pro  94.6   0.025 5.4E-07   52.8   2.7   49   49-101    21-73  (763)
 11 KOG1867 Ubiquitin-specific pro  94.5   0.017 3.6E-07   52.2   1.4   70   49-120    40-111 (492)
 12 PF09416 UPF1_Zn_bind:  RNA hel  93.3     0.2 4.2E-06   38.9   5.1   57   54-110     2-68  (152)
 13 PRK14890 putative Zn-ribbon RN  87.0     0.2 4.2E-06   33.1   0.1   23   52-74     36-58  (59)
 14 COG2888 Predicted Zn-ribbon RN  84.1    0.31 6.7E-06   32.2  -0.1   24   51-74     37-60  (61)
 15 PF14369 zf-RING_3:  zinc-finge  74.5     2.2 4.7E-05   25.0   1.5   13  102-114     2-14  (35)
 16 KOG1802 RNA helicase nonsense   65.2      10 0.00022   36.4   4.4   59   52-110    60-128 (935)
 17 PF08274 PhnA_Zn_Ribbon:  PhnA   63.8       6 0.00013   22.5   1.7   21   53-73      3-28  (30)
 18 cd00729 rubredoxin_SM Rubredox  63.6       4 8.7E-05   23.6   1.0   14   64-77      2-15  (34)
 19 COG1997 RPL43A Ribosomal prote  61.7     6.6 0.00014   27.9   2.0   27   51-77     34-66  (89)
 20 PF14803 Nudix_N_2:  Nudix N-te  59.9     7.7 0.00017   22.6   1.8   13   62-74     20-32  (34)
 21 PF11781 RRN7:  RNA polymerase   56.5       9  0.0002   22.5   1.7   21   53-73      9-34  (36)
 22 cd00350 rubredoxin_like Rubred  55.5     6.3 0.00014   22.4   0.9   13   64-76      1-13  (33)
 23 PF01927 Mut7-C:  Mut7-C RNAse   54.9      10 0.00023   28.4   2.3   26   50-75     89-135 (147)
 24 KOG0704 ADP-ribosylation facto  50.5     6.9 0.00015   34.3   0.8   41   51-104    18-67  (386)
 25 PF01780 Ribosomal_L37ae:  Ribo  49.7      13 0.00028   26.4   1.9   26   52-77     35-66  (90)
 26 smart00661 RPOL9 RNA polymeras  49.6      14 0.00029   22.5   1.8   11   63-73     19-29  (52)
 27 PRK10220 hypothetical protein;  48.8      14 0.00031   27.2   2.0   21   53-73      4-29  (111)
 28 TIGR00686 phnA alkylphosphonat  47.9      14 0.00031   27.1   2.0   22   53-74      3-29  (109)
 29 PF07754 DUF1610:  Domain of un  47.6      14  0.0003   20.0   1.4   11   62-72     14-24  (24)
 30 PF08792 A2L_zn_ribbon:  A2L zi  46.8      19 0.00042   20.7   2.0   23   52-74      3-31  (33)
 31 PF08271 TF_Zn_Ribbon:  TFIIB z  46.6      15 0.00032   21.9   1.6   18   95-112    12-29  (43)
 32 PF05766 NinG:  Bacteriophage L  45.6     8.1 0.00018   30.9   0.4   46   85-135   104-151 (189)
 33 PF10571 UPF0547:  Uncharacteri  45.4      12 0.00027   20.4   1.0   21   54-74      2-24  (26)
 34 COG0777 AccD Acetyl-CoA carbox  44.6     8.1 0.00018   32.9   0.3   24   50-73     26-56  (294)
 35 PF15616 TerY-C:  TerY-C metal   42.7      18 0.00039   27.4   1.8   24   53-77     78-101 (131)
 36 PF01412 ArfGap:  Putative GTPa  42.2      36 0.00079   24.5   3.4   50   51-104    12-61  (116)
 37 KOG0317 Predicted E3 ubiquitin  41.5      18 0.00039   30.9   1.9   41   47-91    234-274 (293)
 38 COG5574 PEX10 RING-finger-cont  39.2      13 0.00029   31.4   0.7   53   50-117   213-266 (271)
 39 smart00154 ZnF_AN1 AN1-like Zi  38.6      26 0.00056   20.7   1.8   23   55-77      1-25  (39)
 40 PF04810 zf-Sec23_Sec24:  Sec23  36.6      24 0.00052   20.8   1.4   12   62-73     22-33  (40)
 41 CHL00174 accD acetyl-CoA carbo  36.4      14  0.0003   31.5   0.5   22   51-72     37-65  (296)
 42 PHA00626 hypothetical protein   35.7      23 0.00049   23.2   1.3   24   53-76     12-35  (59)
 43 TIGR00515 accD acetyl-CoA carb  35.5      15 0.00033   31.0   0.5   23   51-73     25-54  (285)
 44 COG1656 Uncharacterized conser  35.4      22 0.00049   27.9   1.4   27   49-75     94-141 (165)
 45 PF13923 zf-C3HC4_2:  Zinc fing  34.5      33 0.00071   19.6   1.7   31   55-89      1-32  (39)
 46 PF07282 OrfB_Zn_ribbon:  Putat  33.0      40 0.00086   21.6   2.1   23   51-73     27-55  (69)
 47 PRK05654 acetyl-CoA carboxylas  32.9      18 0.00039   30.7   0.6   24   51-74     26-56  (292)
 48 PF05715 zf-piccolo:  Piccolo Z  31.9      26 0.00056   23.2   1.0   19   54-72     32-57  (61)
 49 PHA02942 putative transposase;  31.5      39 0.00084   29.6   2.4   24   51-74    324-352 (383)
 50 PF00096 zf-C2H2:  Zinc finger,  31.0      17 0.00038   18.1   0.1   11   65-75      1-11  (23)
 51 TIGR01031 rpmF_bact ribosomal   30.9      42 0.00091   21.4   1.9   23   51-73     25-48  (55)
 52 PF08882 Acetone_carb_G:  Aceto  30.1      27 0.00059   25.8   1.0   53   62-114    13-86  (112)
 53 PRK12286 rpmF 50S ribosomal pr  29.5      41 0.00089   21.7   1.7   23   51-73     26-49  (57)
 54 PHA00616 hypothetical protein   29.4     8.1 0.00018   23.9  -1.5   25   65-89      2-27  (44)
 55 smart00105 ArfGap Putative GTP  29.2      80  0.0017   22.5   3.4   49   52-104     3-51  (112)
 56 PRK11788 tetratricopeptide rep  27.0      35 0.00075   28.2   1.3   26   51-76    353-380 (389)
 57 COG1592 Rubrerythrin [Energy p  26.0      30 0.00064   27.2   0.7   13   64-76    134-146 (166)
 58 PF13240 zinc_ribbon_2:  zinc-r  25.8      42  0.0009   17.6   1.0   18   55-72      2-21  (23)
 59 PF14968 CCDC84:  Coiled coil p  25.2      50  0.0011   28.8   2.0   25   91-115    44-71  (336)
 60 cd02340 ZZ_NBR1_like Zinc fing  25.0      65  0.0014   19.3   2.0    8   63-70     13-20  (43)
 61 PF04438 zf-HIT:  HIT zinc fing  24.9      34 0.00075   19.2   0.6   22   54-76      4-25  (30)
 62 PF13894 zf-C2H2_4:  C2H2-type   24.9      24 0.00052   17.1  -0.0   11   65-75      1-11  (24)
 63 PF02207 zf-UBR:  Putative zinc  24.2      20 0.00044   23.6  -0.5   40   53-105    14-53  (71)
 64 PTZ00255 60S ribosomal protein  24.0      58  0.0013   23.1   1.8   27   51-77     35-67  (90)
 65 smart00614 ZnF_BED BED zinc fi  23.8      78  0.0017   19.2   2.2   24   66-89     20-45  (50)
 66 COG2023 RPR2 RNase P subunit R  23.8      38 0.00082   24.8   0.8   12   63-74     81-92  (105)
 67 cd02249 ZZ Zinc finger, ZZ typ  23.8      60  0.0013   19.5   1.6   17   55-71      3-21  (46)
 68 PRK14873 primosome assembly pr  23.8      46 0.00099   31.4   1.6   23   51-73    409-431 (665)
 69 PF11261 IRF-2BP1_2:  Interfero  23.7      38 0.00082   21.8   0.7    9  101-109     2-10  (54)
 70 TIGR00280 L37a ribosomal prote  23.1      60  0.0013   23.1   1.7   27   51-77     34-66  (91)
 71 PF14690 zf-ISL3:  zinc-finger   22.8      19 0.00041   21.4  -0.8   41   66-108     4-47  (47)
 72 PF00643 zf-B_box:  B-box zinc   22.7      75  0.0016   18.2   1.9   26   52-77      3-28  (42)
 73 cd00730 rubredoxin Rubredoxin;  22.6      40 0.00087   21.2   0.7   11   65-75      2-12  (50)
 74 COG0675 Transposase and inacti  22.4      65  0.0014   25.9   2.1   26   51-76    308-334 (364)
 75 PRK14704 anaerobic ribonucleos  22.3      52  0.0011   30.8   1.7   25   48-72    555-580 (618)
 76 PF14835 zf-RING_6:  zf-RING of  22.1      59  0.0013   21.8   1.4   26   52-77      7-33  (65)
 77 PF06221 zf-C2HC5:  Putative zi  21.1      31 0.00068   22.4  -0.0   13   65-77     19-31  (57)
 78 COG2051 RPS27A Ribosomal prote  21.1      75  0.0016   21.4   1.8   26   52-77     19-51  (67)
 79 PRK03976 rpl37ae 50S ribosomal  20.9      71  0.0015   22.7   1.7   27   51-77     35-67  (90)
 80 PF01783 Ribosomal_L32p:  Ribos  20.7      51  0.0011   20.9   0.9   23   51-73     25-48  (56)
 81 TIGR03830 CxxCG_CxxCG_HTH puta  20.7      41 0.00089   23.8   0.5   50   83-134    14-64  (127)
 82 PF13920 zf-C3HC4_3:  Zinc fing  20.6      88  0.0019   18.7   1.9   24   53-76      3-27  (50)
 83 PF13719 zinc_ribbon_5:  zinc-r  20.2      25 0.00055   20.4  -0.6   29   32-60      3-33  (37)

No 1  
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]
Probab=99.92  E-value=1.9e-25  Score=201.21  Aligned_cols=109  Identities=30%  Similarity=0.608  Sum_probs=93.7

Q ss_pred             hhcCccccccCCCC-CcccccccccC--CCCCCCCCCCCCCCCCCCCceeccccCeeeecCC------CChhHHHHhhhc
Q 032009           20 MFGAESGWVEPLTS-CDHLVASLSSD--LAHIPTPDTPCNRCQHPSENWLCLCCKEVLCSRF------VNKHMLQHYLET   90 (149)
Q Consensus        20 ~~~~~~~w~~~~~~-CpHl~~~l~~~--~~~i~~~~~~C~~C~~~~~lW~CL~Cg~vgCgr~------~~~Ha~~H~~~t   90 (149)
                      .+..+.+|+.++.. +.|. ..+.|.  .+++++..|+|..|....|||+||+||.|||||.      +|+||+.||++|
T Consensus       145 ~k~~~~aWd~Evr~v~k~~-~nl~q~dng~~~~~~gwkCs~CDL~~NLWlcLtcG~v~CGR~qfg~~GgNgHA~~HYr~t  223 (763)
T KOG0944|consen  145 RKDRVNAWDNEVRTVSKHA-NNLSQIDNGKRIPPSGWKCSKCDLTENLWLCLTCGSVGCGRKQFGGSGGNGHALSHYRET  223 (763)
T ss_pred             hhhhhhhhhhheeeccCCC-CChhhcccCcccCCCcceecccCcccceEEEeccCceeecceeecCCCCCcchHHhhhhc
Confidence            34467899999855 5555 567664  3577789999999999999999999999999993      599999999999


Q ss_pred             CCeeEEECCCC-----cEEEcCCCceecccccCCchhhhHHHHHHhhCCCCC
Q 032009           91 NHSVALSYSDL-----SVWCFTCDAYLNAQVIPQLRPVYETAYILKFGEAPP  137 (149)
Q Consensus        91 ~H~l~v~l~t~-----~vwCY~Cd~~V~~~~~~~L~~~~~~~hl~kfg~~~~  137 (149)
                      +|||+|+|+|+     +||||.||+   ..++|+|     +.||.+|||++.
T Consensus       224 ghPLaVKLgsIs~dg~DvycY~cDd---~v~dPnl-----~~hl~hfGId~~  267 (763)
T KOG0944|consen  224 GHPLAVKLGSISPDGADVYCYDCDD---EVRDPNL-----ESHLSHFGIDMA  267 (763)
T ss_pred             CCceEEEecccCCCccceeeecccc---cccCccH-----HHHHHhcCccHH
Confidence            99999999986     899999994   5577899     899999999984


No 2  
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=99.89  E-value=1.2e-23  Score=139.47  Aligned_cols=61  Identities=46%  Similarity=1.015  Sum_probs=54.2

Q ss_pred             CCCCCCC-CCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEEEcCCCceeccc
Q 032009           55 CNRCQHP-SENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVWCFTCDAYLNAQ  115 (149)
Q Consensus        55 C~~C~~~-~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vwCY~Cd~~V~~~  115 (149)
                      |.+|+.. .++|+||+||++||||+.++||++|+++++|+|+|++.+..||||+|++||+++
T Consensus         1 C~~C~~~~~~lw~CL~Cg~~~C~~~~~~Ha~~H~~~~~H~l~v~~~~~~i~C~~C~~~v~~~   62 (63)
T PF02148_consen    1 CSVCGSTNSNLWLCLTCGYVGCGRYSNGHALKHYKETGHPLAVSLSTGSIWCYACDDYVYDP   62 (63)
T ss_dssp             -SSSHTCSSSEEEETTTS-EEETTTSTSHHHHHHHHHT--EEEETTTTCEEETTTTEEEEST
T ss_pred             CCCCCCcCCceEEeCCCCcccccCCcCcHHHHhhcccCCeEEEECCCCeEEEcCCCcEEeCC
Confidence            7788877 899999999999999998999999999999999999999999999999999864


No 3  
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=99.85  E-value=2.2e-22  Score=177.95  Aligned_cols=108  Identities=25%  Similarity=0.548  Sum_probs=87.8

Q ss_pred             ccccccCCCCCcccccccccCCC-CCCCCCCCCCCCCCCCCceeccccCeeeecC--C---CChhHHHHhhhcCCeeEEE
Q 032009           24 ESGWVEPLTSCDHLVASLSSDLA-HIPTPDTPCNRCQHPSENWLCLCCKEVLCSR--F---VNKHMLQHYLETNHSVALS   97 (149)
Q Consensus        24 ~~~w~~~~~~CpHl~~~l~~~~~-~i~~~~~~C~~C~~~~~lW~CL~Cg~vgCgr--~---~~~Ha~~H~~~t~H~l~v~   97 (149)
                      ..+|+.++.+|+|. ..+..+.. --+....+|+.|....+||+||+||++||||  |   +||||+.||++|+||++|+
T Consensus       145 ~~~w~~E~~tC~H~-~n~~~~s~~~~ni~~~~Cs~CDl~~nLW~Cl~CG~vgCGR~QyG~~GngHAlsHY~~t~Hplavk  223 (749)
T COG5207         145 RVLWRDEEVTCVHG-CNEGPSSIEMGNIGGLKCSLCDLKTNLWVCLSCGYVGCGRMQYGAEGNGHALSHYEETQHPLAVK  223 (749)
T ss_pred             hhhhhhhccccccc-CCCCCCcccccccCCceeccccchhceEEEEecCcccccceeecCCCCcchhhhhhccCCceEEE
Confidence            36799999999999 55544321 1234678899999999999999999999999  2   8999999999999999999


Q ss_pred             CCCC-----cEEEcCCCceecccccCCchhhhHHHHHHhhCCCCC
Q 032009           98 YSDL-----SVWCFTCDAYLNAQVIPQLRPVYETAYILKFGEAPP  137 (149)
Q Consensus        98 l~t~-----~vwCY~Cd~~V~~~~~~~L~~~~~~~hl~kfg~~~~  137 (149)
                      +.++     +||||.||+++-.+.-.++     ..|+..|||++.
T Consensus       224 l~Sls~~~~diyCY~CD~e~R~~~n~n~-----~s~~~~fGinIa  263 (749)
T COG5207         224 LPSLSKEDCDIYCYLCDSEIRSRYNSNE-----NSVTIDFGINIA  263 (749)
T ss_pred             ccccccccccEEEEecCcccccCCcccc-----cceeeeeccchh
Confidence            9965     8999999987644333345     568888999764


No 4  
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]
Probab=99.73  E-value=1.1e-18  Score=152.09  Aligned_cols=64  Identities=31%  Similarity=0.724  Sum_probs=61.0

Q ss_pred             CCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEEEcCCCceecc
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVWCFTCDAYLNA  114 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vwCY~Cd~~V~~  114 (149)
                      ....|..|+.+.+||+||.||++|||||..|||++||++|+|.+++.|+|.+||.|+-|+||+.
T Consensus       227 e~~~c~~c~~~~~LwicliCg~vgcgrY~eghA~rHweet~H~yalel~tqrVWDYAGDnYVhR  290 (493)
T KOG0804|consen  227 ESSLCLACGCTEDLWICLICGNVGCGRYKEGHARRHWEETGHCYALELETQRVWDYAGDNYVHR  290 (493)
T ss_pred             hhhhhhhhcccccEEEEEEccceecccccchhHHHHHHhhcceEEEeecceeeeecccchhhhh
Confidence            3567999999999999999999999999999999999999999999999999999999999986


No 5  
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=99.63  E-value=3.5e-16  Score=136.71  Aligned_cols=69  Identities=22%  Similarity=0.385  Sum_probs=63.2

Q ss_pred             CCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEEEcCCCceecccccCC
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVWCFTCDAYLNAQVIPQ  119 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vwCY~Cd~~V~~~~~~~  119 (149)
                      ....|..|....++|+||+||.++|||++++||..|+.+++|+++|+++|..||||.|++||.+..+.+
T Consensus        15 ~e~~C~~~~~~~n~~~CL~cg~~~~g~~~~~ha~~H~~~~~H~~~v~l~t~~~yc~~~~~~v~d~~l~~   83 (440)
T cd02669          15 FEKVCSVSLSNLNVYACLVCGKYFQGRGKGSHAYTHSLEDNHHVFLNLETLKFYCLPDNYEIIDSSLDD   83 (440)
T ss_pred             ccccccccCCCCcEEEEcccCCeecCCCCCcHHHHHhhccCCCEEEECCCCCEEEeCCCCEEeCccHHH
Confidence            566799999999999999999888888899999999999999999999999999999999998655443


No 6  
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=99.55  E-value=4.3e-15  Score=93.44  Aligned_cols=49  Identities=33%  Similarity=0.750  Sum_probs=46.1

Q ss_pred             CCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCc
Q 032009           54 PCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLS  102 (149)
Q Consensus        54 ~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~  102 (149)
                      +|.+|+...++|+||+|+++||+|+..+|++.|+++++|++++++.++.
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c~~~~~~h~~~H~~~t~H~~~~~~~~~~   49 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGCGRYQLGHALEHFEETGHPLVVKLGTQR   49 (50)
T ss_pred             CcccCCCcCCeEEecCCCCcccCCCCCcHHHHHhhhhCCCEEEEccccc
Confidence            5999999889999999999999999889999999999999999998864


No 7  
>KOG1873 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones]
Probab=99.51  E-value=3.6e-15  Score=136.39  Aligned_cols=79  Identities=29%  Similarity=0.740  Sum_probs=64.7

Q ss_pred             CCCcccccccccC-C-CCCC-CCCCCCCCCCCC---------------CCceeccccCeeeecC-CCChhHHHHhhhc--
Q 032009           32 TSCDHLVASLSSD-L-AHIP-TPDTPCNRCQHP---------------SENWLCLCCKEVLCSR-FVNKHMLQHYLET--   90 (149)
Q Consensus        32 ~~CpHl~~~l~~~-~-~~i~-~~~~~C~~C~~~---------------~~lW~CL~Cg~vgCgr-~~~~Ha~~H~~~t--   90 (149)
                      ..|.|+.+++.+. + +.+. ..+..|.+|...               ..+|+||.||+.|||| ....|+++||+..  
T Consensus        43 ~~C~Hi~Kav~l~~lk~~iks~~~~~C~eC~e~~~~k~g~s~~~~~~~~~iWLCLkCG~q~CG~~~~~~halkH~~~~r~  122 (877)
T KOG1873|consen   43 VECQHIKKAVDLSHLKRAIKSLLWIKCSECNEEVKVKDGGSSDQFEFDNAIWLCLKCGYQGCGRNSESQHALKHFLTPRS  122 (877)
T ss_pred             cccchHHhhhcHHHHHHHHHHHHHHHHHHhhhcceeccCCCccccccccceeeecccCCeeeCCCcccchhhhhhcccCC
Confidence            4499998888764 2 1121 256679999862               4699999999999999 6789999999875  


Q ss_pred             -CCeeEEECCCCcEEEcCCCc
Q 032009           91 -NHSVALSYSDLSVWCFTCDA  110 (149)
Q Consensus        91 -~H~l~v~l~t~~vwCY~Cd~  110 (149)
                       .|+|+|++.++.||||.||.
T Consensus       123 ~~Hclvin~~n~~~WCy~Cd~  143 (877)
T KOG1873|consen  123 EPHCLVINLINWLIWCYSCDA  143 (877)
T ss_pred             CCeeEEEEeeeeeeEEEeccc
Confidence             59999999999999999998


No 8  
>KOG2026 consensus Spindle pole body protein - Sad1p [Cytoskeleton]
Probab=96.20  E-value=0.0045  Score=54.38  Aligned_cols=67  Identities=22%  Similarity=0.403  Sum_probs=58.2

Q ss_pred             CCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCC-CcEEEcCCCceeccccc
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSD-LSVWCFTCDAYLNAQVI  117 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t-~~vwCY~Cd~~V~~~~~  117 (149)
                      ....|..-...-+.+.||.||...=||....||..|.-+.||-+.+++.| ...|+..-++.+++...
T Consensus        28 ~ek~c~vslsnLnvyAclvcg~y~qgr~~kS~A~~h~l~~ghhvf~nl~telkfyvlpe~~ei~d~s~   95 (442)
T KOG2026|consen   28 FEKPCSVSLSNLNVYACLVCGKYFQGRGEKSHAYTHSLEEGHHVFLNLSTELKFYVLPENYEIDDPSL   95 (442)
T ss_pred             CCCCCcccccccceeeeeeeCchhhCcCccccchhccccccccceeccccceeEEecchhccccCchh
Confidence            45568888888899999999999999999999999999999999999999 78888887766665443


No 9  
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones]
Probab=95.48  E-value=0.0023  Score=58.19  Aligned_cols=69  Identities=22%  Similarity=0.387  Sum_probs=50.2

Q ss_pred             CCCcccccccccCCCCCC--CCCCCCCCCCCC----CCceeccccCeeeecCCCChhH-HHHhhhcCCeeEEECCCC
Q 032009           32 TSCDHLVASLSSDLAHIP--TPDTPCNRCQHP----SENWLCLCCKEVLCSRFVNKHM-LQHYLETNHSVALSYSDL  101 (149)
Q Consensus        32 ~~CpHl~~~l~~~~~~i~--~~~~~C~~C~~~----~~lW~CL~Cg~vgCgr~~~~Ha-~~H~~~t~H~l~v~l~t~  101 (149)
                      +.|+|. ...+..+..++  .+...|..|+.+    ..+-+||.|++.+|++-+--|. +.|+..|=|++.+-+...
T Consensus         1 ~S~~H~-e~ae~vlpn~~av~~reeC~yCf~S~~~e~si~vClnCfqs~C~~h~~~H~~~~~~c~tvh~i~~tia~~   76 (749)
T COG5207           1 KSFSHS-EMAEMVLPNLPAVRFREECCYCFRSIGDEHSISVCLNCFQSFCEKHRGIHLGTKSGCRTVHDIKETIADL   76 (749)
T ss_pred             CCCchh-hhhhhcCCCCchhhhhhhhheeeccCCCCcceehHHHHhHhhhhhccceeecchhhhhhhhhhhhhhhhc
Confidence            478998 32322222222  256679999975    4588999999999999777787 699999999988766543


No 10 
>KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones]
Probab=94.61  E-value=0.025  Score=52.79  Aligned_cols=49  Identities=22%  Similarity=0.438  Sum_probs=42.4

Q ss_pred             CCCCCCCCCCCCC----CCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCC
Q 032009           49 PTPDTPCNRCQHP----SENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDL  101 (149)
Q Consensus        49 ~~~~~~C~~C~~~----~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~  101 (149)
                      .+.+..|..|+.+    .+|++||.|....+    ..|...||.+|+|++++.|+..
T Consensus        21 ~i~kdeC~ycf~sp~~e~glyicl~~f~afg----~~~v~~~f~~tg~~~yl~i~r~   73 (763)
T KOG0944|consen   21 VIYKDECAYCFDSPESEGGLYICLNCFLAFG----REHVEEYFRKTGHSVYLHIARV   73 (763)
T ss_pred             ceehhhceeeccCCCCCCCEEeehhhhhhhh----hHHHHHHHhhcCceEEEEeccc
Confidence            3478889999985    67999999998855    5799999999999999999854


No 11 
>KOG1867 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones]
Probab=94.54  E-value=0.017  Score=52.16  Aligned_cols=70  Identities=23%  Similarity=0.552  Sum_probs=57.5

Q ss_pred             CCCCCCCCCCCC-CCCcee-ccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEEEcCCCceecccccCCc
Q 032009           49 PTPDTPCNRCQH-PSENWL-CLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVWCFTCDAYLNAQVIPQL  120 (149)
Q Consensus        49 ~~~~~~C~~C~~-~~~lW~-CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vwCY~Cd~~V~~~~~~~L  120 (149)
                      +.....|..|.. ...+.. |+.|+.++|.  .+.|...|....+|-+.+++.++-.+||.|++||+.....++
T Consensus        40 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~g~~~~~~c~~~i~~~~~~~~  111 (492)
T KOG1867|consen   40 PLKTINCGTCGVLQIRLAVPCLICDSLGCL--SNSHKLEHSGNKKHNNTIDVNNGLLYCFACPDFIYDAELLKL  111 (492)
T ss_pred             ccccceeEEechhhhhhcccceechhcccc--cccccccccccccccccceeehhhheeccCCcEeeccchhhH
Confidence            335566777775 344555 8999999995  577999999999999999999999999999999988665555


No 12 
>PF09416 UPF1_Zn_bind:  RNA helicase (UPF2 interacting domain);  InterPro: IPR018999 UPF1 (or regulator of nonsense transcripts 1 homologue) is an essential RNA helicase that detects mRNAs containing premature stop codons and triggers their degradation. This domain contains 3 zinc binding motifs and forms interactions with another protein (UPF2) that is also involved nonsense-mediated mRNA decay (NMD) []. ; GO: 0003677 DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay, 0005737 cytoplasm; PDB: 2IYK_B 2WJY_A 2WJV_A 2XZL_A.
Probab=93.32  E-value=0.2  Score=38.88  Aligned_cols=57  Identities=23%  Similarity=0.559  Sum_probs=33.8

Q ss_pred             CCCCCCC--CCCceeccccCeeeecCC---CChhHHHHhhhcCCeeEEEC-----CCCcEEEcCCCc
Q 032009           54 PCNRCQH--PSENWLCLCCKEVLCSRF---VNKHMLQHYLETNHSVALSY-----SDLSVWCFTCDA  110 (149)
Q Consensus        54 ~C~~C~~--~~~lW~CL~Cg~vgCgr~---~~~Ha~~H~~~t~H~l~v~l-----~t~~vwCY~Cd~  110 (149)
                      .|..|+.  ...+-.|+.|++-+|-..   ...|+..|...++|.-+.--     ++..+-||.|..
T Consensus         2 aC~YCG~~~p~~vv~C~~c~kWFCNg~~~~s~SHIv~HLv~srh~ev~LH~~s~lgdt~leCy~Cg~   68 (152)
T PF09416_consen    2 ACAYCGIHDPSCVVKCNTCNKWFCNGRGNTSGSHIVNHLVRSRHKEVSLHPDSPLGDTVLECYNCGS   68 (152)
T ss_dssp             S-TTT----CCCEEEETTTTEEEES--TTSSS-HHHHHHHHHT---EEE-TTSTT-S-B---TTT--
T ss_pred             CccccCCCCcccEeEcCCCCcEeecCCCCCcccHHHHHHHHccCCceeeCCCCCCCCcEEEEEecCC
Confidence            5899994  577899999999999752   56899999999998744332     234799999984


No 13 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=87.01  E-value=0.2  Score=33.05  Aligned_cols=23  Identities=22%  Similarity=0.486  Sum_probs=20.8

Q ss_pred             CCCCCCCCCCCCceeccccCeee
Q 032009           52 DTPCNRCQHPSENWLCLCCKEVL   74 (149)
Q Consensus        52 ~~~C~~C~~~~~lW~CL~Cg~vg   74 (149)
                      .++|..|....+.+.|..|||.|
T Consensus        36 I~RC~~CRk~~~~Y~CP~CGF~G   58 (59)
T PRK14890         36 IYRCEKCRKQSNPYTCPKCGFEG   58 (59)
T ss_pred             EeechhHHhcCCceECCCCCCcC
Confidence            57899999999999999999986


No 14 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=84.11  E-value=0.31  Score=32.24  Aligned_cols=24  Identities=17%  Similarity=0.376  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCCCceeccccCeee
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEVL   74 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~vg   74 (149)
                      ..++|..|....+.+.|..|||.|
T Consensus        37 ~I~Rc~~CRk~g~~Y~Cp~CGF~G   60 (61)
T COG2888          37 EIYRCAKCRKLGNPYRCPKCGFEG   60 (61)
T ss_pred             eeehhhhHHHcCCceECCCcCccC
Confidence            457888888899999999999986


No 15 
>PF14369 zf-RING_3:  zinc-finger
Probab=74.54  E-value=2.2  Score=24.99  Aligned_cols=13  Identities=23%  Similarity=1.122  Sum_probs=11.2

Q ss_pred             cEEEcCCCceecc
Q 032009          102 SVWCFTCDAYLNA  114 (149)
Q Consensus       102 ~vwCY~Cd~~V~~  114 (149)
                      ..|||.|+..|..
T Consensus         2 ~ywCh~C~~~V~~   14 (35)
T PF14369_consen    2 RYWCHQCNRFVRI   14 (35)
T ss_pred             CEeCccCCCEeEe
Confidence            5799999999875


No 16 
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]
Probab=65.24  E-value=10  Score=36.41  Aligned_cols=59  Identities=19%  Similarity=0.496  Sum_probs=46.7

Q ss_pred             CCCCCCCCCCC--CceeccccCeeeecCC---CChhHHHHhhhcCCeeEEECCC-----CcEEEcCCCc
Q 032009           52 DTPCNRCQHPS--ENWLCLCCKEVLCSRF---VNKHMLQHYLETNHSVALSYSD-----LSVWCFTCDA  110 (149)
Q Consensus        52 ~~~C~~C~~~~--~lW~CL~Cg~vgCgr~---~~~Ha~~H~~~t~H~l~v~l~t-----~~vwCY~Cd~  110 (149)
                      .-.|..|+...  .+--|.+||.-+|-..   ..+|+..|...+.|.-+--..+     ..+=||.|..
T Consensus        60 ~~~c~Ycgi~~p~~v~kc~~c~Kwfcn~r~gtsgshIv~hlvra~hk~v~lh~ds~lget~lecyncg~  128 (935)
T KOG1802|consen   60 EHACAYCGISEPACVIKCNTCGKWFCNSRGGTSGSHIVNHLVRAKHKEVSLHKDSPLGETVLECYNCGS  128 (935)
T ss_pred             hhhhhhccCCCchheeeccccCceeecCCCCCchhHHHHHHHHhhhheeEeccCCCCCcceEEeeccCc
Confidence            34599999876  6778999999999642   5689999999999887665554     3688999983


No 17 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=63.78  E-value=6  Score=22.50  Aligned_cols=21  Identities=24%  Similarity=0.555  Sum_probs=12.8

Q ss_pred             CCCCCCCCC-----CCceeccccCee
Q 032009           53 TPCNRCQHP-----SENWLCLCCKEV   73 (149)
Q Consensus        53 ~~C~~C~~~-----~~lW~CL~Cg~v   73 (149)
                      .+|..|+..     ..+++|-.||+.
T Consensus         3 p~Cp~C~se~~y~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    3 PKCPLCGSEYTYEDGELLVCPECGHE   28 (30)
T ss_dssp             ---TTT-----EE-SSSEEETTTTEE
T ss_pred             CCCCCCCCcceeccCCEEeCCccccc
Confidence            468888874     678999999974


No 18 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=63.62  E-value=4  Score=23.58  Aligned_cols=14  Identities=21%  Similarity=0.707  Sum_probs=11.6

Q ss_pred             ceeccccCeeeecC
Q 032009           64 NWLCLCCKEVLCSR   77 (149)
Q Consensus        64 lW~CL~Cg~vgCgr   77 (149)
                      .|+|..||++.=|+
T Consensus         2 ~~~C~~CG~i~~g~   15 (34)
T cd00729           2 VWVCPVCGYIHEGE   15 (34)
T ss_pred             eEECCCCCCEeECC
Confidence            69999999996554


No 19 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=61.66  E-value=6.6  Score=27.86  Aligned_cols=27  Identities=19%  Similarity=0.549  Sum_probs=22.3

Q ss_pred             CCCCCCCCCCC------CCceeccccCeeeecC
Q 032009           51 PDTPCNRCQHP------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        51 ~~~~C~~C~~~------~~lW~CL~Cg~vgCgr   77 (149)
                      ..-.|..|+..      ..+|.|-.||+.+-|-
T Consensus        34 ~~~~Cp~C~~~~VkR~a~GIW~C~kCg~~fAGg   66 (89)
T COG1997          34 AKHVCPFCGRTTVKRIATGIWKCRKCGAKFAGG   66 (89)
T ss_pred             cCCcCCCCCCcceeeeccCeEEcCCCCCeeccc
Confidence            34569999974      6899999999998875


No 20 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=59.93  E-value=7.7  Score=22.60  Aligned_cols=13  Identities=23%  Similarity=0.570  Sum_probs=9.9

Q ss_pred             CCceeccccCeee
Q 032009           62 SENWLCLCCKEVL   74 (149)
Q Consensus        62 ~~lW~CL~Cg~vg   74 (149)
                      ..-++|..||+|.
T Consensus        20 r~R~vC~~Cg~Ih   32 (34)
T PF14803_consen   20 RERLVCPACGFIH   32 (34)
T ss_dssp             S-EEEETTTTEEE
T ss_pred             ccceECCCCCCEE
Confidence            5568999999884


No 21 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=56.50  E-value=9  Score=22.49  Aligned_cols=21  Identities=24%  Similarity=0.648  Sum_probs=15.5

Q ss_pred             CCCCCCCCC-----CCceeccccCee
Q 032009           53 TPCNRCQHP-----SENWLCLCCKEV   73 (149)
Q Consensus        53 ~~C~~C~~~-----~~lW~CL~Cg~v   73 (149)
                      .+|.+|+..     .+.+.|-.||++
T Consensus         9 ~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    9 EPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             CcCCCCCCeEeEccCCEEEhhhCceE
Confidence            459999874     567788888875


No 22 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=55.48  E-value=6.3  Score=22.43  Aligned_cols=13  Identities=15%  Similarity=0.613  Sum_probs=10.3

Q ss_pred             ceeccccCeeeec
Q 032009           64 NWLCLCCKEVLCS   76 (149)
Q Consensus        64 lW~CL~Cg~vgCg   76 (149)
                      .|+|..||++.=+
T Consensus         1 ~~~C~~CGy~y~~   13 (33)
T cd00350           1 KYVCPVCGYIYDG   13 (33)
T ss_pred             CEECCCCCCEECC
Confidence            4899999998544


No 23 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=54.88  E-value=10  Score=28.45  Aligned_cols=26  Identities=27%  Similarity=0.759  Sum_probs=20.3

Q ss_pred             CCCCCCCCCCCC---------------------CCceeccccCeeee
Q 032009           50 TPDTPCNRCQHP---------------------SENWLCLCCKEVLC   75 (149)
Q Consensus        50 ~~~~~C~~C~~~---------------------~~lW~CL~Cg~vgC   75 (149)
                      +..++|..|+..                     ...|.|..||.+.=
T Consensus        89 ~~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiyW  135 (147)
T PF01927_consen   89 PIFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIYW  135 (147)
T ss_pred             CCCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEec
Confidence            356899999972                     35899999999853


No 24 
>KOG0704 consensus ADP-ribosylation factor GTPase activator [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton]
Probab=50.53  E-value=6.9  Score=34.35  Aligned_cols=41  Identities=20%  Similarity=0.484  Sum_probs=27.0

Q ss_pred             CCCCCCCCCCC--------CCceeccccCeeeecCCCChhHHHHhhhcC-CeeEEECCCCcEE
Q 032009           51 PDTPCNRCQHP--------SENWLCLCCKEVLCSRFVNKHMLQHYLETN-HSVALSYSDLSVW  104 (149)
Q Consensus        51 ~~~~C~~C~~~--------~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~-H~l~v~l~t~~vw  104 (149)
                      ....|.+|+..        -++||||.|.-+.             +-.| |--+|..-|++=|
T Consensus        18 eNk~CfeC~a~NPQWvSvsyGIfICLECSG~H-------------RgLGVhiSFVRSVTMD~w   67 (386)
T KOG0704|consen   18 ENKKCFECGAPNPQWVSVSYGIFICLECSGKH-------------RGLGVHISFVRSVTMDKW   67 (386)
T ss_pred             cCCceeecCCCCCCeEeecccEEEEEecCCcc-------------cccceeeEEEEeeecccc
Confidence            45679999984        4678999996331             1222 6666666666666


No 25 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=49.73  E-value=13  Score=26.44  Aligned_cols=26  Identities=19%  Similarity=0.586  Sum_probs=20.8

Q ss_pred             CCCCCCCCCC------CCceeccccCeeeecC
Q 032009           52 DTPCNRCQHP------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        52 ~~~C~~C~~~------~~lW~CL~Cg~vgCgr   77 (149)
                      .-.|..|+..      .++|-|-.||+..-|-
T Consensus        35 ky~Cp~Cgk~~vkR~a~GIW~C~~C~~~~AGG   66 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRVATGIWKCKKCGKKFAGG   66 (90)
T ss_dssp             -BEESSSSSSEEEEEETTEEEETTTTEEEE-B
T ss_pred             CCcCCCCCCceeEEeeeEEeecCCCCCEEeCC
Confidence            3459999974      7899999999999886


No 26 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=49.60  E-value=14  Score=22.45  Aligned_cols=11  Identities=18%  Similarity=0.558  Sum_probs=8.7

Q ss_pred             CceeccccCee
Q 032009           63 ENWLCLCCKEV   73 (149)
Q Consensus        63 ~lW~CL~Cg~v   73 (149)
                      +.|+|-.||+.
T Consensus        19 ~~~vC~~Cg~~   29 (52)
T smart00661       19 RRFVCRKCGYE   29 (52)
T ss_pred             CEEECCcCCCe
Confidence            47889988876


No 27 
>PRK10220 hypothetical protein; Provisional
Probab=48.81  E-value=14  Score=27.21  Aligned_cols=21  Identities=19%  Similarity=0.705  Sum_probs=17.1

Q ss_pred             CCCCCCCCC-----CCceeccccCee
Q 032009           53 TPCNRCQHP-----SENWLCLCCKEV   73 (149)
Q Consensus        53 ~~C~~C~~~-----~~lW~CL~Cg~v   73 (149)
                      ..|..|...     .++|+|..|++-
T Consensus         4 P~CP~C~seytY~d~~~~vCpeC~hE   29 (111)
T PRK10220          4 PHCPKCNSEYTYEDNGMYICPECAHE   29 (111)
T ss_pred             CcCCCCCCcceEcCCCeEECCcccCc
Confidence            468888863     789999999976


No 28 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=47.86  E-value=14  Score=27.11  Aligned_cols=22  Identities=23%  Similarity=0.742  Sum_probs=17.4

Q ss_pred             CCCCCCCCC-----CCceeccccCeee
Q 032009           53 TPCNRCQHP-----SENWLCLCCKEVL   74 (149)
Q Consensus        53 ~~C~~C~~~-----~~lW~CL~Cg~vg   74 (149)
                      ..|..|...     .++|+|..|++.-
T Consensus         3 p~CP~C~seytY~dg~~~iCpeC~~EW   29 (109)
T TIGR00686         3 PPCPKCNSEYTYHDGTQLICPSCLYEW   29 (109)
T ss_pred             CcCCcCCCcceEecCCeeECccccccc
Confidence            358888863     7899999999863


No 29 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=47.56  E-value=14  Score=20.02  Aligned_cols=11  Identities=18%  Similarity=0.410  Sum_probs=7.5

Q ss_pred             CCceeccccCe
Q 032009           62 SENWLCLCCKE   72 (149)
Q Consensus        62 ~~lW~CL~Cg~   72 (149)
                      ...+.|..||+
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            45677777774


No 30 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=46.82  E-value=19  Score=20.70  Aligned_cols=23  Identities=17%  Similarity=0.627  Sum_probs=15.7

Q ss_pred             CCCCCCCCCC------CCceeccccCeee
Q 032009           52 DTPCNRCQHP------SENWLCLCCKEVL   74 (149)
Q Consensus        52 ~~~C~~C~~~------~~lW~CL~Cg~vg   74 (149)
                      .+.|..|+..      .+..+|..||.+.
T Consensus         3 ~~~C~~C~~~~i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    3 LKKCSKCGGNGIVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             ceEcCCCCCCeEEEecCCeEEcccCCcEe
Confidence            3568888764      4556888888763


No 31 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=46.64  E-value=15  Score=21.89  Aligned_cols=18  Identities=17%  Similarity=0.296  Sum_probs=7.4

Q ss_pred             EEECCCCcEEEcCCCcee
Q 032009           95 ALSYSDLSVWCFTCDAYL  112 (149)
Q Consensus        95 ~v~l~t~~vwCY~Cd~~V  112 (149)
                      ..+-.++.+-|-.|..-|
T Consensus        12 ~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen   12 VFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             EEETTTTEEEETTT-BBE
T ss_pred             EEcCCCCeEECCCCCCEe
Confidence            334444444444444333


No 32 
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=45.64  E-value=8.1  Score=30.94  Aligned_cols=46  Identities=22%  Similarity=0.530  Sum_probs=31.1

Q ss_pred             HHhhhcCCeeEEECCC--CcEEEcCCCceecccccCCchhhhHHHHHHhhCCC
Q 032009           85 QHYLETNHSVALSYSD--LSVWCFTCDAYLNAQVIPQLRPVYETAYILKFGEA  135 (149)
Q Consensus        85 ~H~~~t~H~l~v~l~t--~~vwCY~Cd~~V~~~~~~~L~~~~~~~hl~kfg~~  135 (149)
                      .||...+....+-+..  ..-=|-.|+.+....+.     .|+...+.++|+.
T Consensus       104 gHy~s~g~~~~lRF~~~N~~~qC~~CN~~~sgn~~-----~Yr~~Li~kiG~~  151 (189)
T PF05766_consen  104 GHYRSRGAAPELRFNEDNIHAQCKHCNRHLSGNIV-----EYRIGLIEKIGQE  151 (189)
T ss_pred             ccccccccCcccccChhhHhHcCCccccccccCHH-----HHHHHHHHHHhHH
Confidence            3777777655565654  45569999988765333     3667778888864


No 33 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=45.40  E-value=12  Score=20.42  Aligned_cols=21  Identities=19%  Similarity=0.534  Sum_probs=13.7

Q ss_pred             CCCCCCCC--CCceeccccCeee
Q 032009           54 PCNRCQHP--SENWLCLCCKEVL   74 (149)
Q Consensus        54 ~C~~C~~~--~~lW~CL~Cg~vg   74 (149)
                      .|.+|+..  ...-.|-.||+.+
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCCCC
Confidence            47777754  4455788888753


No 34 
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=44.57  E-value=8.1  Score=32.91  Aligned_cols=24  Identities=25%  Similarity=0.386  Sum_probs=19.5

Q ss_pred             CCCCCCCCCCC-------CCCceeccccCee
Q 032009           50 TPDTPCNRCQH-------PSENWLCLCCKEV   73 (149)
Q Consensus        50 ~~~~~C~~C~~-------~~~lW~CL~Cg~v   73 (149)
                      ..+.+|..|+.       ..|+|+|+.|++-
T Consensus        26 ~lw~KCp~c~~~~y~~eL~~n~~vcp~c~~h   56 (294)
T COG0777          26 GLWTKCPSCGEMLYRKELESNLKVCPKCGHH   56 (294)
T ss_pred             CceeECCCccceeeHHHHHhhhhcccccCcc
Confidence            36678999997       3789999999864


No 35 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=42.70  E-value=18  Score=27.38  Aligned_cols=24  Identities=21%  Similarity=0.677  Sum_probs=21.2

Q ss_pred             CCCCCCCCCCCceeccccCeeeecC
Q 032009           53 TPCNRCQHPSENWLCLCCKEVLCSR   77 (149)
Q Consensus        53 ~~C~~C~~~~~lW~CL~Cg~vgCgr   77 (149)
                      ..|.-|+.....-+| .||++.|-.
T Consensus        78 PgCP~CGn~~~fa~C-~CGkl~Ci~  101 (131)
T PF15616_consen   78 PGCPHCGNQYAFAVC-GCGKLFCID  101 (131)
T ss_pred             CCCCCCcChhcEEEe-cCCCEEEeC
Confidence            569999999899999 899999953


No 36 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=42.23  E-value=36  Score=24.47  Aligned_cols=50  Identities=20%  Similarity=0.385  Sum_probs=30.9

Q ss_pred             CCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEE
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVW  104 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vw  104 (149)
                      ....|.+|+.....|+++.=|.+-|.    ..+-.|-.-..|---|+.-+++-|
T Consensus        12 ~N~~CaDCg~~~p~w~s~~~GiflC~----~Cag~HR~lg~~is~VkSi~~d~w   61 (116)
T PF01412_consen   12 GNKVCADCGAPNPTWASLNYGIFLCL----ECAGIHRSLGVHISRVKSITMDNW   61 (116)
T ss_dssp             TCTB-TTT-SBS--EEETTTTEEE-H----HHHHHHHHHTTTT--EEETTTS--
T ss_pred             CcCcCCCCCCCCCCEEEeecChhhhH----HHHHHHHHhcccchhccccccCCC
Confidence            55789999999999999998888885    567777554446666666666655


No 37 
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]
Probab=41.53  E-value=18  Score=30.88  Aligned_cols=41  Identities=22%  Similarity=0.440  Sum_probs=32.7

Q ss_pred             CCCCCCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcC
Q 032009           47 HIPTPDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETN   91 (149)
Q Consensus        47 ~i~~~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~   91 (149)
                      .++...-+|.-|......-.|.-||+++|    ....+.+..+..
T Consensus       234 ~i~~a~~kC~LCLe~~~~pSaTpCGHiFC----WsCI~~w~~ek~  274 (293)
T KOG0317|consen  234 SIPEATRKCSLCLENRSNPSATPCGHIFC----WSCILEWCSEKA  274 (293)
T ss_pred             cCCCCCCceEEEecCCCCCCcCcCcchHH----HHHHHHHHcccc
Confidence            34445678999999999999999999999    467778766543


No 38 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=39.21  E-value=13  Score=31.36  Aligned_cols=53  Identities=21%  Similarity=0.465  Sum_probs=35.9

Q ss_pred             CCCCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCC-cEEEcCCCceeccccc
Q 032009           50 TPDTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDL-SVWCFTCDAYLNAQVI  117 (149)
Q Consensus        50 ~~~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~-~vwCY~Cd~~V~~~~~  117 (149)
                      ...-+|.-|....+.-.|..||+++|-               |++.+..... .-+|-.|...|+.+.+
T Consensus       213 ~~d~kC~lC~e~~~~ps~t~CgHlFC~---------------~Cl~~~~t~~k~~~CplCRak~~pk~v  266 (271)
T COG5574         213 LADYKCFLCLEEPEVPSCTPCGHLFCL---------------SCLLISWTKKKYEFCPLCRAKVYPKKV  266 (271)
T ss_pred             ccccceeeeecccCCcccccccchhhH---------------HHHHHHHHhhccccCchhhhhccchhh
Confidence            345679999999999999999999995               2222222222 2347777777665443


No 39 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=38.57  E-value=26  Score=20.75  Aligned_cols=23  Identities=22%  Similarity=0.791  Sum_probs=17.0

Q ss_pred             CCCCCCCCCc--eeccccCeeeecC
Q 032009           55 CNRCQHPSEN--WLCLCCKEVLCSR   77 (149)
Q Consensus        55 C~~C~~~~~l--W~CL~Cg~vgCgr   77 (149)
                      |..|+....|  ..|-.|+.++|.+
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~   25 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGE   25 (39)
T ss_pred             CcccCCcccccCeECCccCCccccc
Confidence            5667765444  6799999999974


No 40 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=36.58  E-value=24  Score=20.84  Aligned_cols=12  Identities=25%  Similarity=0.983  Sum_probs=7.9

Q ss_pred             CCceeccccCee
Q 032009           62 SENWLCLCCKEV   73 (149)
Q Consensus        62 ~~lW~CL~Cg~v   73 (149)
                      ...|.|-.|+..
T Consensus        22 ~~~w~C~~C~~~   33 (40)
T PF04810_consen   22 GKTWICNFCGTK   33 (40)
T ss_dssp             TTEEEETTT--E
T ss_pred             CCEEECcCCCCc
Confidence            468999988865


No 41 
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=36.36  E-value=14  Score=31.54  Aligned_cols=22  Identities=23%  Similarity=0.388  Sum_probs=18.5

Q ss_pred             CCCCCCCCCCC-------CCceeccccCe
Q 032009           51 PDTPCNRCQHP-------SENWLCLCCKE   72 (149)
Q Consensus        51 ~~~~C~~C~~~-------~~lW~CL~Cg~   72 (149)
                      .+.+|..|+..       .++++|..||+
T Consensus        37 lw~kc~~C~~~~~~~~l~~~~~vcp~c~~   65 (296)
T CHL00174         37 LWVQCENCYGLNYKKFLKSKMNICEQCGY   65 (296)
T ss_pred             CeeECCCccchhhHHHHHHcCCCCCCCCC
Confidence            46789999974       67899999997


No 42 
>PHA00626 hypothetical protein
Probab=35.68  E-value=23  Score=23.25  Aligned_cols=24  Identities=13%  Similarity=0.186  Sum_probs=19.9

Q ss_pred             CCCCCCCCCCCceeccccCeeeec
Q 032009           53 TPCNRCQHPSENWLCLCCKEVLCS   76 (149)
Q Consensus        53 ~~C~~C~~~~~lW~CL~Cg~vgCg   76 (149)
                      .+|..|...++.+.|-.||+..--
T Consensus        12 vrcg~cr~~snrYkCkdCGY~ft~   35 (59)
T PHA00626         12 AKEKTMRGWSDDYVCCDCGYNDSK   35 (59)
T ss_pred             eeeceecccCcceEcCCCCCeech
Confidence            368888888999999999998653


No 43 
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=35.46  E-value=15  Score=31.01  Aligned_cols=23  Identities=22%  Similarity=0.437  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCC-------CCceeccccCee
Q 032009           51 PDTPCNRCQHP-------SENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~-------~~lW~CL~Cg~v   73 (149)
                      .+.+|..|+..       .++++|..||+-
T Consensus        25 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h   54 (285)
T TIGR00515        25 VWTKCPKCGQVLYTKELERNLEVCPKCDHH   54 (285)
T ss_pred             CeeECCCCcchhhHHHHHhhCCCCCCCCCc
Confidence            46789999973       678899999873


No 44 
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=35.39  E-value=22  Score=27.92  Aligned_cols=27  Identities=19%  Similarity=0.444  Sum_probs=20.4

Q ss_pred             CCCCCCCCCCCCC---------------------CCceeccccCeeee
Q 032009           49 PTPDTPCNRCQHP---------------------SENWLCLCCKEVLC   75 (149)
Q Consensus        49 ~~~~~~C~~C~~~---------------------~~lW~CL~Cg~vgC   75 (149)
                      .+..++|..|+..                     ...|.|-.||.++=
T Consensus        94 ~~e~~RCp~CN~~L~~vs~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW  141 (165)
T COG1656          94 FPEFSRCPECNGELEKVSREEVKEKVPEKVYRNYEEFYRCPKCGKIYW  141 (165)
T ss_pred             ccccccCcccCCEeccCcHHHHhhccchhhhhcccceeECCCCccccc
Confidence            3467889999862                     35789999998853


No 45 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=34.47  E-value=33  Score=19.63  Aligned_cols=31  Identities=13%  Similarity=0.379  Sum_probs=19.6

Q ss_pred             CCCCCCC-CCceeccccCeeeecCCCChhHHHHhhh
Q 032009           55 CNRCQHP-SENWLCLCCKEVLCSRFVNKHMLQHYLE   89 (149)
Q Consensus        55 C~~C~~~-~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~   89 (149)
                      |..|... .+.++-+.||+++|.    .-+.++.+.
T Consensus         1 C~iC~~~~~~~~~~~~CGH~fC~----~C~~~~~~~   32 (39)
T PF13923_consen    1 CPICLDELRDPVVVTPCGHSFCK----ECIEKYLEK   32 (39)
T ss_dssp             ETTTTSB-SSEEEECTTSEEEEH----HHHHHHHHC
T ss_pred             CCCCCCcccCcCEECCCCCchhH----HHHHHHHHC
Confidence            4456543 456688999999995    344444433


No 46 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=33.01  E-value=40  Score=21.63  Aligned_cols=23  Identities=26%  Similarity=0.645  Sum_probs=17.1

Q ss_pred             CCCCCCCCCCC------CCceeccccCee
Q 032009           51 PDTPCNRCQHP------SENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~------~~lW~CL~Cg~v   73 (149)
                      ....|..|+..      ...|.|..||+.
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            34458888863      467899999987


No 47 
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=32.94  E-value=18  Score=30.65  Aligned_cols=24  Identities=21%  Similarity=0.416  Sum_probs=18.9

Q ss_pred             CCCCCCCCCCC-------CCceeccccCeee
Q 032009           51 PDTPCNRCQHP-------SENWLCLCCKEVL   74 (149)
Q Consensus        51 ~~~~C~~C~~~-------~~lW~CL~Cg~vg   74 (149)
                      .+.+|..|+..       .++++|..||+-.
T Consensus        26 ~~~~c~~c~~~~~~~~l~~~~~vc~~c~~h~   56 (292)
T PRK05654         26 LWTKCPSCGQVLYRKELEANLNVCPKCGHHM   56 (292)
T ss_pred             CeeECCCccchhhHHHHHhcCCCCCCCCCCe
Confidence            46789999973       6788999998743


No 48 
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=31.93  E-value=26  Score=23.21  Aligned_cols=19  Identities=42%  Similarity=1.135  Sum_probs=12.6

Q ss_pred             CCCCCCCC-------CCceeccccCe
Q 032009           54 PCNRCQHP-------SENWLCLCCKE   72 (149)
Q Consensus        54 ~C~~C~~~-------~~lW~CL~Cg~   72 (149)
                      .|..|+..       ..-|+||.|-.
T Consensus        32 VCnlCGFNP~Phl~E~~eWLCLnCQ~   57 (61)
T PF05715_consen   32 VCNLCGFNPTPHLTEVKEWLCLNCQM   57 (61)
T ss_pred             hhcccCCCCCccccccceeeeecchh
Confidence            46666653       46799998853


No 49 
>PHA02942 putative transposase; Provisional
Probab=31.48  E-value=39  Score=29.57  Aligned_cols=24  Identities=21%  Similarity=0.599  Sum_probs=17.6

Q ss_pred             CCCCCCCCCCC-----CCceeccccCeee
Q 032009           51 PDTPCNRCQHP-----SENWLCLCCKEVL   74 (149)
Q Consensus        51 ~~~~C~~C~~~-----~~lW~CL~Cg~vg   74 (149)
                      ....|..|+..     ...|.|..||+..
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            34459999853     3578999999874


No 50 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=30.97  E-value=17  Score=18.12  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=7.7

Q ss_pred             eeccccCeeee
Q 032009           65 WLCLCCKEVLC   75 (149)
Q Consensus        65 W~CL~Cg~vgC   75 (149)
                      |.|..||..+=
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            46777887754


No 51 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=30.94  E-value=42  Score=21.43  Aligned_cols=23  Identities=17%  Similarity=0.392  Sum_probs=18.4

Q ss_pred             CCCCCCCCCCC-CCceeccccCee
Q 032009           51 PDTPCNRCQHP-SENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~-~~lW~CL~Cg~v   73 (149)
                      ....|..|+.. ..--+|..||+.
T Consensus        25 ~l~~C~~cG~~~~~H~vc~~cG~Y   48 (55)
T TIGR01031        25 TLVVCPNCGEFKLPHRVCPSCGYY   48 (55)
T ss_pred             cceECCCCCCcccCeeECCccCeE
Confidence            55679999975 567799999976


No 52 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=30.06  E-value=27  Score=25.80  Aligned_cols=53  Identities=15%  Similarity=0.343  Sum_probs=34.3

Q ss_pred             CCceeccc--------cCeeeecCC--CChhHHHHhhhcC--C----eeEEECCCC-----cEEEcCCCceecc
Q 032009           62 SENWLCLC--------CKEVLCSRF--VNKHMLQHYLETN--H----SVALSYSDL-----SVWCFTCDAYLNA  114 (149)
Q Consensus        62 ~~lW~CL~--------Cg~vgCgr~--~~~Ha~~H~~~t~--H----~l~v~l~t~-----~vwCY~Cd~~V~~  114 (149)
                      ..+|+|-.        ||+.+|.-.  =..|++.|-+++.  |    |..+.-...     ..||=.|...++.
T Consensus        13 ~~l~i~~~~~k~vkc~CGh~f~d~r~NwK~~alv~vRd~~E~~~~iYp~~~aPdp~w~~irEyyCP~Cgt~lev   86 (112)
T PF08882_consen   13 PHLWIVQKKDKVVKCDCGHEFCDARENWKLGALVYVRDPEEIHPEIYPFTMAPDPEWQVIREYYCPGCGTQLEV   86 (112)
T ss_pred             CcEEEEEecCceeeccCCCeecChhcChhhCcEEEecChHHhhhhhcccccCCCCCcEEEEEEECCCCcceeEE
Confidence            56777777        999999852  3367777766554  3    233332222     6899999987765


No 53 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=29.54  E-value=41  Score=21.70  Aligned_cols=23  Identities=22%  Similarity=0.551  Sum_probs=18.1

Q ss_pred             CCCCCCCCCCC-CCceeccccCee
Q 032009           51 PDTPCNRCQHP-SENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~-~~lW~CL~Cg~v   73 (149)
                      ....|..|+.. ..--+|..||+.
T Consensus        26 ~l~~C~~CG~~~~~H~vC~~CG~Y   49 (57)
T PRK12286         26 GLVECPNCGEPKLPHRVCPSCGYY   49 (57)
T ss_pred             cceECCCCCCccCCeEECCCCCcC
Confidence            55679999975 467799999965


No 54 
>PHA00616 hypothetical protein
Probab=29.44  E-value=8.1  Score=23.93  Aligned_cols=25  Identities=24%  Similarity=0.507  Sum_probs=15.5

Q ss_pred             eeccccCeeeecCC-CChhHHHHhhh
Q 032009           65 WLCLCCKEVLCSRF-VNKHMLQHYLE   89 (149)
Q Consensus        65 W~CL~Cg~vgCgr~-~~~Ha~~H~~~   89 (149)
                      ..|+.||.++.-.. -..|.+.|..+
T Consensus         2 YqC~~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          2 YQCLRCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CccchhhHHHhhHHHHHHHHHHhcCC
Confidence            46999999988542 33455555443


No 55 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=29.22  E-value=80  Score=22.54  Aligned_cols=49  Identities=20%  Similarity=0.388  Sum_probs=31.9

Q ss_pred             CCCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEE
Q 032009           52 DTPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVW  104 (149)
Q Consensus        52 ~~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vw  104 (149)
                      ...|.+|+.....|+++.=|-+-|.+    .+-.|-.-..|--.|..-+++.|
T Consensus         3 N~~CaDC~~~~p~w~s~~~GifvC~~----CsgiHR~lg~his~VkSl~md~w   51 (112)
T smart00105        3 NKKCFDCGAPNPTWASVNLGVFLCIE----CSGIHRSLGVHISKVRSLTLDTW   51 (112)
T ss_pred             CCcccCCCCCCCCcEEeccceeEhHH----hHHHHHhcCCCcCeeeecccCCC
Confidence            35799999988899999999998864    44455433335333444444433


No 56 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=26.99  E-value=35  Score=28.17  Aligned_cols=26  Identities=23%  Similarity=0.549  Sum_probs=20.0

Q ss_pred             CCCCCCCCCCCCCce--eccccCeeeec
Q 032009           51 PDTPCNRCQHPSENW--LCLCCKEVLCS   76 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW--~CL~Cg~vgCg   76 (149)
                      -.+.|..|+.....|  .|..||..+--
T Consensus       353 p~~~c~~cg~~~~~~~~~c~~c~~~~~~  380 (389)
T PRK11788        353 PRYRCRNCGFTARTLYWHCPSCKAWETI  380 (389)
T ss_pred             CCEECCCCCCCCccceeECcCCCCccCc
Confidence            346799999887755  89999987643


No 57 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=26.02  E-value=30  Score=27.18  Aligned_cols=13  Identities=23%  Similarity=0.672  Sum_probs=11.1

Q ss_pred             ceeccccCeeeec
Q 032009           64 NWLCLCCKEVLCS   76 (149)
Q Consensus        64 lW~CL~Cg~vgCg   76 (149)
                      .|+|..||++.=|
T Consensus       134 ~~vC~vCGy~~~g  146 (166)
T COG1592         134 VWVCPVCGYTHEG  146 (166)
T ss_pred             EEEcCCCCCcccC
Confidence            8999999998554


No 58 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=25.77  E-value=42  Score=17.64  Aligned_cols=18  Identities=22%  Similarity=0.726  Sum_probs=8.2

Q ss_pred             CCCCCCC--CCceeccccCe
Q 032009           55 CNRCQHP--SENWLCLCCKE   72 (149)
Q Consensus        55 C~~C~~~--~~lW~CL~Cg~   72 (149)
                      |..|+..  .+.-.|..||.
T Consensus         2 Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    2 CPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CcccCCCCCCcCcchhhhCC
Confidence            4455532  23334555553


No 59 
>PF14968 CCDC84:  Coiled coil protein 84
Probab=25.21  E-value=50  Score=28.76  Aligned_cols=25  Identities=24%  Similarity=0.668  Sum_probs=19.6

Q ss_pred             CCeeEEECCC---CcEEEcCCCceeccc
Q 032009           91 NHSVALSYSD---LSVWCFTCDAYLNAQ  115 (149)
Q Consensus        91 ~H~l~v~l~t---~~vwCY~Cd~~V~~~  115 (149)
                      .+|.+++...   ..+|||-|+..|...
T Consensus        44 k~p~v~~~~~~~~~~fWC~fC~~ev~~~   71 (336)
T PF14968_consen   44 KKPSVLRYDPEHRNRFWCVFCDCEVREH   71 (336)
T ss_pred             hCCccCCCCccccceeEeeCccchhhhc
Confidence            5888877653   589999999888643


No 60 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=25.02  E-value=65  Score=19.34  Aligned_cols=8  Identities=38%  Similarity=1.140  Sum_probs=4.0

Q ss_pred             Cceecccc
Q 032009           63 ENWLCLCC   70 (149)
Q Consensus        63 ~lW~CL~C   70 (149)
                      .-|-|+.|
T Consensus        13 ~ry~C~~C   20 (43)
T cd02340          13 VRYKCLVC   20 (43)
T ss_pred             CeEECCCC
Confidence            34455555


No 61 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=24.89  E-value=34  Score=19.17  Aligned_cols=22  Identities=27%  Similarity=0.788  Sum_probs=15.7

Q ss_pred             CCCCCCCCCCceeccccCeeeec
Q 032009           54 PCNRCQHPSENWLCLCCKEVLCS   76 (149)
Q Consensus        54 ~C~~C~~~~~lW~CL~Cg~vgCg   76 (149)
                      .|..|+. ...+.|..|+.-.|+
T Consensus         4 ~C~vC~~-~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    4 LCSVCGN-PAKYRCPRCGARYCS   25 (30)
T ss_dssp             EETSSSS-EESEE-TTT--EESS
T ss_pred             CCccCcC-CCEEECCCcCCceeC
Confidence            4888888 788899999988885


No 62 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=24.88  E-value=24  Score=17.10  Aligned_cols=11  Identities=18%  Similarity=0.622  Sum_probs=6.1

Q ss_pred             eeccccCeeee
Q 032009           65 WLCLCCKEVLC   75 (149)
Q Consensus        65 W~CL~Cg~vgC   75 (149)
                      |.|-.|++..=
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            56777777754


No 63 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=24.20  E-value=20  Score=23.62  Aligned_cols=40  Identities=25%  Similarity=0.451  Sum_probs=25.8

Q ss_pred             CCCCCCCCCCCceeccccCeeeecCCCChhHHHHhhhcCCeeEEECCCCcEEE
Q 032009           53 TPCNRCQHPSENWLCLCCKEVLCSRFVNKHMLQHYLETNHSVALSYSDLSVWC  105 (149)
Q Consensus        53 ~~C~~C~~~~~lW~CL~Cg~vgCgr~~~~Ha~~H~~~t~H~l~v~l~t~~vwC  105 (149)
                      -+|.+|......-+|+.|...+|      |.       ||-+.+-..+...+|
T Consensus        14 y~C~tC~~~~~~~iC~~CF~~~~------H~-------gH~~~~~~~~~~~~C   53 (71)
T PF02207_consen   14 YRCLTCSLDESSGICEECFANSC------HE-------GHRVVYYRSSSGGCC   53 (71)
T ss_dssp             EEETTTBSSTT-BBEHHHHCTSG------GG-------GSSEEEEE--SCEBB
T ss_pred             EECccCCCCCCEEEchhhCCCCC------cC-------CCcEEEEEeCCCeEE
Confidence            46888988888889999876656      33       677776666633333


No 64 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=23.95  E-value=58  Score=23.13  Aligned_cols=27  Identities=22%  Similarity=0.555  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCC------CCceeccccCeeeecC
Q 032009           51 PDTPCNRCQHP------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        51 ~~~~C~~C~~~------~~lW~CL~Cg~vgCgr   77 (149)
                      ..-.|..|+..      .++|.|-.||+..-|.
T Consensus        35 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQAVGIWRCKGCKKTVAGG   67 (90)
T ss_pred             CCccCCCCCCCceeeeeeEEEEcCCCCCEEeCC
Confidence            34569999763      5799999999998875


No 65 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=23.84  E-value=78  Score=19.21  Aligned_cols=24  Identities=17%  Similarity=0.279  Sum_probs=16.7

Q ss_pred             eccccCeeeecC--CCChhHHHHhhh
Q 032009           66 LCLCCKEVLCSR--FVNKHMLQHYLE   89 (149)
Q Consensus        66 ~CL~Cg~vgCgr--~~~~Ha~~H~~~   89 (149)
                      .|-.|+.+.-..  .+.+|..+|...
T Consensus        20 ~C~~C~~~l~~~~~~gTs~L~rHl~~   45 (50)
T smart00614       20 KCKYCGKKLSRSSKGGTSNLRRHLRR   45 (50)
T ss_pred             EecCCCCEeeeCCCCCcHHHHHHHHh
Confidence            566666665544  577899999875


No 66 
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=23.84  E-value=38  Score=24.76  Aligned_cols=12  Identities=25%  Similarity=0.437  Sum_probs=10.0

Q ss_pred             CceeccccCeee
Q 032009           63 ENWLCLCCKEVL   74 (149)
Q Consensus        63 ~lW~CL~Cg~vg   74 (149)
                      -.|.||.||++-
T Consensus        81 v~vtC~~CG~~~   92 (105)
T COG2023          81 VVVTCLECGTIR   92 (105)
T ss_pred             EEEEecCCCcEE
Confidence            478999999873


No 67 
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=23.83  E-value=60  Score=19.46  Aligned_cols=17  Identities=29%  Similarity=0.991  Sum_probs=8.1

Q ss_pred             CCCCCC--CCCceeccccC
Q 032009           55 CNRCQH--PSENWLCLCCK   71 (149)
Q Consensus        55 C~~C~~--~~~lW~CL~Cg   71 (149)
                      |..|+.  .+..|.|+.|.
T Consensus         3 C~~C~~~i~g~r~~C~~C~   21 (46)
T cd02249           3 CDGCLKPIVGVRYHCLVCE   21 (46)
T ss_pred             CcCCCCCCcCCEEECCCCC
Confidence            444443  23445555554


No 68 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=23.77  E-value=46  Score=31.38  Aligned_cols=23  Identities=22%  Similarity=0.706  Sum_probs=18.2

Q ss_pred             CCCCCCCCCCCCCceeccccCee
Q 032009           51 PDTPCNRCQHPSENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~~~lW~CL~Cg~v   73 (149)
                      ...+|..|+.....|.|..||.-
T Consensus       409 ~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        409 GTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             CeeECCCCcCCCcCccCCCCcCC
Confidence            34679999987778999999864


No 69 
>PF11261 IRF-2BP1_2:  Interferon regulatory factor 2-binding protein zinc finger;  InterPro: IPR022750  IRF-2BP1 and IRF-2BP2 are nuclear transcriptional repressor proteins and can inhibit both enhancer-activated and basal transcription. They both contain N-terminal zinc finger and C-terminal RING finger domains [].  This entry represents the N-terminal zinc finger domain of IRF-2BP1 and IRF-2BP2.
Probab=23.72  E-value=38  Score=21.80  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=7.1

Q ss_pred             CcEEEcCCC
Q 032009          101 LSVWCFTCD  109 (149)
Q Consensus       101 ~~vwCY~Cd  109 (149)
                      .+.|||.||
T Consensus         2 ~Rq~CyLCd   10 (54)
T PF11261_consen    2 RRQQCYLCD   10 (54)
T ss_pred             CceeEEecc
Confidence            467899888


No 70 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=23.10  E-value=60  Score=23.09  Aligned_cols=27  Identities=19%  Similarity=0.530  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCC------CCceeccccCeeeecC
Q 032009           51 PDTPCNRCQHP------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        51 ~~~~C~~C~~~------~~lW~CL~Cg~vgCgr   77 (149)
                      ..-.|.-|+..      .++|.|-.||+..-|-
T Consensus        34 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        34 AKYVCPFCGKKTVKRGSTGIWTCRKCGAKFAGG   66 (91)
T ss_pred             cCccCCCCCCCceEEEeeEEEEcCCCCCEEeCC
Confidence            34569999763      6799999999998875


No 71 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=22.77  E-value=19  Score=21.36  Aligned_cols=41  Identities=17%  Similarity=0.244  Sum_probs=25.5

Q ss_pred             eccccCeeeecCCCChh---HHHHhhhcCCeeEEECCCCcEEEcCC
Q 032009           66 LCLCCKEVLCSRFVNKH---MLQHYLETNHSVALSYSDLSVWCFTC  108 (149)
Q Consensus        66 ~CL~Cg~vgCgr~~~~H---a~~H~~~t~H~l~v~l~t~~vwCY~C  108 (149)
                      .|..||...  ...+|.   ...|..-.+.++.|.+.-..+.|-.|
T Consensus         4 ~Cp~Cg~~~--~~~~g~~~r~i~~l~~~~~~~~L~i~~~R~~C~~C   47 (47)
T PF14690_consen    4 RCPHCGSPS--VHRHGYKTRRIRHLPIGGRPVYLRIRKRRYRCKNC   47 (47)
T ss_pred             cCCCcCCCc--eECCceEEEEEeecccCCEEEEEEEEeEEEECcCC
Confidence            356666554  112222   23355556789999999888888766


No 72 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=22.67  E-value=75  Score=18.19  Aligned_cols=26  Identities=27%  Similarity=0.630  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCCceeccccCeeeecC
Q 032009           52 DTPCNRCQHPSENWLCLCCKEVLCSR   77 (149)
Q Consensus        52 ~~~C~~C~~~~~lW~CL~Cg~vgCgr   77 (149)
                      ...|..+....-.+.|..|+..-|..
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~   28 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSE   28 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHH
T ss_pred             CccCccCCccceEEEecCCCCccCcc
Confidence            34688888776788999999999975


No 73 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=22.64  E-value=40  Score=21.19  Aligned_cols=11  Identities=18%  Similarity=0.519  Sum_probs=8.1

Q ss_pred             eeccccCeeee
Q 032009           65 WLCLCCKEVLC   75 (149)
Q Consensus        65 W~CL~Cg~vgC   75 (149)
                      |+|..||++.=
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            77888888744


No 74 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=22.41  E-value=65  Score=25.91  Aligned_cols=26  Identities=23%  Similarity=0.441  Sum_probs=19.0

Q ss_pred             CCCCCCCCCCC-CCceeccccCeeeec
Q 032009           51 PDTPCNRCQHP-SENWLCLCCKEVLCS   76 (149)
Q Consensus        51 ~~~~C~~C~~~-~~lW~CL~Cg~vgCg   76 (149)
                      ....|..|+.. ...|.|..||+..=-
T Consensus       308 tS~~C~~cg~~~~r~~~C~~cg~~~~r  334 (364)
T COG0675         308 TSKTCPCCGHLSGRLFKCPRCGFVHDR  334 (364)
T ss_pred             CcccccccCCccceeEECCCCCCeehh
Confidence            44569999863 467889999887543


No 75 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.34  E-value=52  Score=30.77  Aligned_cols=25  Identities=24%  Similarity=0.468  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCCCCCCCc-eeccccCe
Q 032009           48 IPTPDTPCNRCQHPSEN-WLCLCCKE   72 (149)
Q Consensus        48 i~~~~~~C~~C~~~~~l-W~CL~Cg~   72 (149)
                      +++..+.|..|+....+ |.|..||.
T Consensus       555 in~~~~~C~~CGy~g~~~~~CP~CG~  580 (618)
T PRK14704        555 INHPVDRCKCCSYHGVIGNECPSCGN  580 (618)
T ss_pred             eCCCCeecCCCCCCCCcCccCcCCCC
Confidence            34467789999976565 99999995


No 76 
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=22.09  E-value=59  Score=21.80  Aligned_cols=26  Identities=27%  Similarity=0.673  Sum_probs=11.6

Q ss_pred             CCCCCCCCCCCCceeccc-cCeeeecC
Q 032009           52 DTPCNRCQHPSENWLCLC-CKEVLCSR   77 (149)
Q Consensus        52 ~~~C~~C~~~~~lW~CL~-Cg~vgCgr   77 (149)
                      ..+|+.|+..-+.-+||. |.+++|.-
T Consensus         7 lLrCs~C~~~l~~pv~l~~CeH~fCs~   33 (65)
T PF14835_consen    7 LLRCSICFDILKEPVCLGGCEHIFCSS   33 (65)
T ss_dssp             TTS-SSS-S--SS-B---SSS--B-TT
T ss_pred             hcCCcHHHHHhcCCceeccCccHHHHH
Confidence            457999998877777865 99999964


No 77 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=21.13  E-value=31  Score=22.39  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=11.0

Q ss_pred             eeccccCeeeecC
Q 032009           65 WLCLCCKEVLCSR   77 (149)
Q Consensus        65 W~CL~Cg~vgCgr   77 (149)
                      -.||.||.|-|..
T Consensus        19 ~NCl~CGkIiC~~   31 (57)
T PF06221_consen   19 PNCLNCGKIICEQ   31 (57)
T ss_pred             ccccccChhhccc
Confidence            4699999999964


No 78 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=21.09  E-value=75  Score=21.42  Aligned_cols=26  Identities=27%  Similarity=0.579  Sum_probs=19.7

Q ss_pred             CCCCCCCCCC-------CCceeccccCeeeecC
Q 032009           52 DTPCNRCQHP-------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        52 ~~~C~~C~~~-------~~lW~CL~Cg~vgCgr   77 (149)
                      ..+|.+|+..       .-.-.|+.||.+-+-.
T Consensus        19 ~VkCpdC~N~q~vFshast~V~C~~CG~~l~~P   51 (67)
T COG2051          19 RVKCPDCGNEQVVFSHASTVVTCLICGTTLAEP   51 (67)
T ss_pred             EEECCCCCCEEEEeccCceEEEecccccEEEec
Confidence            4579999974       3455899999998854


No 79 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=20.89  E-value=71  Score=22.68  Aligned_cols=27  Identities=22%  Similarity=0.647  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCC------CCceeccccCeeeecC
Q 032009           51 PDTPCNRCQHP------SENWLCLCCKEVLCSR   77 (149)
Q Consensus        51 ~~~~C~~C~~~------~~lW~CL~Cg~vgCgr   77 (149)
                      ..-.|.-|+..      ..+|-|-.||+..-|.
T Consensus        35 a~y~CpfCgk~~vkR~a~GIW~C~~C~~~~AGG   67 (90)
T PRK03976         35 AKHVCPVCGRPKVKRVGTGIWECRKCGAKFAGG   67 (90)
T ss_pred             cCccCCCCCCCceEEEEEEEEEcCCCCCEEeCC
Confidence            44569999753      6799999999998875


No 80 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=20.72  E-value=51  Score=20.92  Aligned_cols=23  Identities=22%  Similarity=0.560  Sum_probs=16.3

Q ss_pred             CCCCCCCCCCC-CCceeccccCee
Q 032009           51 PDTPCNRCQHP-SENWLCLCCKEV   73 (149)
Q Consensus        51 ~~~~C~~C~~~-~~lW~CL~Cg~v   73 (149)
                      ....|..|+.. ..--+|..||+.
T Consensus        25 ~l~~c~~cg~~~~~H~vc~~cG~y   48 (56)
T PF01783_consen   25 NLVKCPNCGEPKLPHRVCPSCGYY   48 (56)
T ss_dssp             SEEESSSSSSEESTTSBCTTTBBS
T ss_pred             ceeeeccCCCEecccEeeCCCCeE
Confidence            44568888864 456789999854


No 81 
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=20.70  E-value=41  Score=23.78  Aligned_cols=50  Identities=14%  Similarity=0.140  Sum_probs=27.7

Q ss_pred             HHHHhhhcCCeeEEECCCCcEEEcCCCceec-ccccCCchhhhHHHHHHhhCC
Q 032009           83 MLQHYLETNHSVALSYSDLSVWCFTCDAYLN-AQVIPQLRPVYETAYILKFGE  134 (149)
Q Consensus        83 a~~H~~~t~H~l~v~l~t~~vwCY~Cd~~V~-~~~~~~L~~~~~~~hl~kfg~  134 (149)
                      ...|+.-.|+.+.+++  --.+|-.|+..+. ......+.+.+..+++++-|.
T Consensus        14 ~~~~~~~~G~~~~v~~--~~~~C~~CGe~~~~~e~~~~~~~~i~~~~~~~~~~   64 (127)
T TIGR03830        14 KDEPYTYKGESITIGV--PGWYCPACGEELLDPEESKRNSAALADFYRKVDGL   64 (127)
T ss_pred             ecceEEEcCEEEEEee--eeeECCCCCCEEEcHHHHHHHHHHHHHHHHHccCC
Confidence            3445667778888822  2337888886654 334444444444444444443


No 82 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=20.59  E-value=88  Score=18.72  Aligned_cols=24  Identities=21%  Similarity=0.610  Sum_probs=19.4

Q ss_pred             CCCCCCCCCCCceeccccCee-eec
Q 032009           53 TPCNRCQHPSENWLCLCCKEV-LCS   76 (149)
Q Consensus        53 ~~C~~C~~~~~lW~CL~Cg~v-gCg   76 (149)
                      ..|..|.......+-+-||+. .|.
T Consensus         3 ~~C~iC~~~~~~~~~~pCgH~~~C~   27 (50)
T PF13920_consen    3 EECPICFENPRDVVLLPCGHLCFCE   27 (50)
T ss_dssp             SB-TTTSSSBSSEEEETTCEEEEEH
T ss_pred             CCCccCCccCCceEEeCCCChHHHH
Confidence            468899988888888999999 885


No 83 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=20.19  E-value=25  Score=20.41  Aligned_cols=29  Identities=17%  Similarity=0.512  Sum_probs=16.1

Q ss_pred             CCCcccccccccCCCCCC--CCCCCCCCCCC
Q 032009           32 TSCDHLVASLSSDLAHIP--TPDTPCNRCQH   60 (149)
Q Consensus        32 ~~CpHl~~~l~~~~~~i~--~~~~~C~~C~~   60 (149)
                      ..||+-...++.+...++  ....+|..|+.
T Consensus         3 i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~   33 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDKLPAGGRKVRCPKCGH   33 (37)
T ss_pred             EECCCCCceEEcCHHHcccCCcEEECCCCCc
Confidence            468887444444332232  35567888863


Done!