Citrus Sinensis ID: 032010

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MAASSYTAPEKQKPLLELEEHEEKHFTSSEIVRDIIIGVSDGLTVPFALAAGLSGADVPSSIILIAGIAEVAAGAVSMGLGGYLAAKSEADHYVRELKREQEEIINAPDIEAAECAEILAQYGAEPHEYEGVVNALKRNPKHWLDFMMK
cccccccccccccccccccHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHc
****************************SEIVRDIIIGVSDGLTVPFALAAGLSGADVPSSIILIAGIAEVAAGAVSMGLGGYLAAKSEADHYVRELKREQEEIINAPDIEAAECAEILAQYGAEPHEYEGVVNALKRNPKHWLDFMMK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSYTAPEKQKPLLELEEHEEKHFTSSEIVRDIIIGVSDGLTVPFALAAGLSGADVPSSIILIAGIAEVAAGAVSMGLGGxxxxxxxxxxxxxxxxxxxxxIINAPDIEAAECAEILAQYGAEPHEYEGVVNALKRNPKHWLDFMMK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar iron transporter 1.2 Probable vacuolar iron transporter that may be involved in the transfer of iron from the cytosol to the vacuole for intracellular iron storage.probableQ6ERE5
Vacuolar iron transporter 1.1 Probable vacuolar iron transporter that may be involved in the transfer of iron from the cytosol to the vacuole for intracellular iron storage.probableQ6MWE5
Vacuolar iron transporter 1 Vacuolar iron transporter involved in the transfer of iron from the cytosol to the vacuole for intracellular iron storage. Vacuolar iron storage is required for seed embryo and seedling development.probableQ9ZUA5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted