BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032014
         (149 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LWE|A Chain A, The Crystal Structure Of Mpp8
 pdb|3LWE|B Chain B, The Crystal Structure Of Mpp8
 pdb|3R93|A Chain A, Crystal Structure Of The Chromo Domain Of M-Phase
          Phosphoprotein 8 Bound To H3k9me3 Peptide
 pdb|3R93|B Chain B, Crystal Structure Of The Chromo Domain Of M-Phase
          Phosphoprotein 8 Bound To H3k9me3 Peptide
 pdb|3R93|C Chain C, Crystal Structure Of The Chromo Domain Of M-Phase
          Phosphoprotein 8 Bound To H3k9me3 Peptide
 pdb|3R93|D Chain D, Crystal Structure Of The Chromo Domain Of M-Phase
          Phosphoprotein 8 Bound To H3k9me3 Peptide
 pdb|3SVM|A Chain A, Human Mpp8 - Human Dnmt3ak47me2 Peptide
          Length = 62

 Score = 26.9 bits (58), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 53 IFNISAVTDRSVSGGKVMIEVRYFGIRVHSET 84
          +F +  + D    GGKV+ +VR+ G     +T
Sbjct: 4  VFEVEKILDMKTEGGKVLYKVRWKGYTSDDDT 35


>pdb|3QO2|A Chain A, Structural Insights For Mpp8 Chromodomain Interaction
          With Histone H3 Lysine 9
 pdb|3QO2|B Chain B, Structural Insights For Mpp8 Chromodomain Interaction
          With Histone H3 Lysine 9
 pdb|3QO2|C Chain C, Structural Insights For Mpp8 Chromodomain Interaction
          With Histone H3 Lysine 9
 pdb|3QO2|D Chain D, Structural Insights For Mpp8 Chromodomain Interaction
          With Histone H3 Lysine 9
          Length = 64

 Score = 26.9 bits (58), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 17/32 (53%)

Query: 53 IFNISAVTDRSVSGGKVMIEVRYFGIRVHSET 84
          +F +  + D    GGKV+ +VR+ G     +T
Sbjct: 6  VFEVEKILDMKTEGGKVLYKVRWKGYTSDDDT 37


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.141    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,443,922
Number of Sequences: 62578
Number of extensions: 175949
Number of successful extensions: 295
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 293
Number of HSP's gapped (non-prelim): 9
length of query: 149
length of database: 14,973,337
effective HSP length: 90
effective length of query: 59
effective length of database: 9,341,317
effective search space: 551137703
effective search space used: 551137703
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)