BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032019
         (148 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZTB|A Chain A, Crystal Structure Of Chorismate Synthase From
           Mycobacterium Tuberculosis
 pdb|2G85|A Chain A, Crystal Structure Of Chorismate Synthase From
           Mycobacterium Tuberculosis At 2.22 Angstrons Of
           Resolution
          Length = 401

 Score = 26.9 bits (58), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%)

Query: 37  GYMFAKARKKNSRVEDRKRPGPHD---EDNQATDAVSSGLTPASPLSEEPSVPPTVIEP 92
           G  F  AR++ SR  D   PGP       N+A   +  G+T   PL    ++ P    P
Sbjct: 264 GDGFQTARRRGSRAHDEMYPGPDGVVRSTNRA-GGLEGGMTNGQPLRVRAAMKPISTVP 321


>pdb|2O11|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase
 pdb|2O12|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase In Complex
           With Fmn
 pdb|2QHF|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase In Complex
           With Nca
          Length = 407

 Score = 26.9 bits (58), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%)

Query: 37  GYMFAKARKKNSRVEDRKRPGPHD---EDNQATDAVSSGLTPASPLSEEPSVPPTVIEP 92
           G  F  AR++ SR  D   PGP       N+A   +  G+T   PL    ++ P    P
Sbjct: 264 GDGFQTARRRGSRAHDEMYPGPDGVVRSTNRA-GGLEGGMTNGQPLRVRAAMKPISTVP 321


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.133    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,875,736
Number of Sequences: 62578
Number of extensions: 138240
Number of successful extensions: 274
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 269
Number of HSP's gapped (non-prelim): 7
length of query: 148
length of database: 14,973,337
effective HSP length: 90
effective length of query: 58
effective length of database: 9,341,317
effective search space: 541796386
effective search space used: 541796386
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.7 bits)