BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032019
(148 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1ZTB|A Chain A, Crystal Structure Of Chorismate Synthase From
Mycobacterium Tuberculosis
pdb|2G85|A Chain A, Crystal Structure Of Chorismate Synthase From
Mycobacterium Tuberculosis At 2.22 Angstrons Of
Resolution
Length = 401
Score = 26.9 bits (58), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%)
Query: 37 GYMFAKARKKNSRVEDRKRPGPHD---EDNQATDAVSSGLTPASPLSEEPSVPPTVIEP 92
G F AR++ SR D PGP N+A + G+T PL ++ P P
Sbjct: 264 GDGFQTARRRGSRAHDEMYPGPDGVVRSTNRA-GGLEGGMTNGQPLRVRAAMKPISTVP 321
>pdb|2O11|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase
pdb|2O12|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase In Complex
With Fmn
pdb|2QHF|A Chain A, Mycobacterium Tuberculosis Chorismate Synthase In Complex
With Nca
Length = 407
Score = 26.9 bits (58), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 4/59 (6%)
Query: 37 GYMFAKARKKNSRVEDRKRPGPHD---EDNQATDAVSSGLTPASPLSEEPSVPPTVIEP 92
G F AR++ SR D PGP N+A + G+T PL ++ P P
Sbjct: 264 GDGFQTARRRGSRAHDEMYPGPDGVVRSTNRA-GGLEGGMTNGQPLRVRAAMKPISTVP 321
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.133 0.390
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,875,736
Number of Sequences: 62578
Number of extensions: 138240
Number of successful extensions: 274
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 269
Number of HSP's gapped (non-prelim): 7
length of query: 148
length of database: 14,973,337
effective HSP length: 90
effective length of query: 58
effective length of database: 9,341,317
effective search space: 541796386
effective search space used: 541796386
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.7 bits)