Query         032019
Match_columns 148
No_of_seqs    33 out of 35
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 08:29:47 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032019.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032019hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF11169 DUF2956:  Protein of u  73.5     1.3 2.7E-05   34.0   0.4   24   18-41     80-103 (103)
  2 PF14147 Spore_YhaL:  Sporulati  66.0     1.1 2.3E-05   30.8  -1.3   27   24-50      3-29  (52)
  3 KOG3727 Mitogen inducible gene  62.3     3.7 8.1E-05   39.6   1.1   21   30-50    629-649 (664)
  4 PF09911 DUF2140:  Uncharacteri  59.8     6.6 0.00014   31.6   2.0   27   21-47      3-29  (187)
  5 PF08078 PsaX:  PsaX family;  I  57.4     4.9 0.00011   26.0   0.7   21   20-40     13-34  (37)
  6 PF14283 DUF4366:  Domain of un  57.1      16 0.00035   30.5   3.9   34   14-50    156-189 (218)
  7 PF15012 DUF4519:  Domain of un  56.2     6.3 0.00014   27.4   1.1   25   22-46     32-56  (56)
  8 cd03489 Topoisomer_IB_N_Ldtopo  55.9      11 0.00024   32.1   2.7   34  105-138    85-118 (212)
  9 PRK10819 transport protein Ton  55.0      19 0.00041   30.3   4.0   17   17-35      8-26  (246)
 10 PF14163 SieB:  Superinfection   54.1     9.1  0.0002   29.0   1.8   14  130-143    81-94  (151)
 11 cd00660 Topoisomer_IB_N Topois  54.1      12 0.00026   31.9   2.7   34  105-138    88-121 (215)
 12 cd03490 Topoisomer_IB_N_1 Topo  52.9      13 0.00028   31.8   2.6   34  105-138    87-120 (217)
 13 cd03488 Topoisomer_IB_N_htopoI  52.4      13 0.00029   31.6   2.7   34  105-138    88-121 (215)
 14 PRK14745 RepA leader peptide T  51.8     8.4 0.00018   23.2   1.0   16   21-36      7-22  (26)
 15 PF14854 LURAP:  Leucine rich a  49.2      13 0.00028   29.4   1.9   19  102-120    49-67  (121)
 16 PF14164 YqzH:  YqzH-like prote  49.0      19 0.00042   25.5   2.7   22   96-117    23-44  (64)
 17 PRK12757 cell division protein  48.0      91   0.002   27.0   7.1   17  101-117    81-97  (256)
 18 TIGR02223 ftsN cell division p  47.0 1.2E+02  0.0027   26.3   7.8   17  102-118   116-132 (298)
 19 TIGR03475 tap_IncFII_lead RepA  46.1      13 0.00028   22.5   1.2   17   21-37      7-23  (26)
 20 PF08048 RepA1_leader:  Tap Rep  45.8      14 0.00031   22.1   1.4   17   21-37      7-23  (25)
 21 PF15055 DUF4536:  Domain of un  44.6     3.2 6.8E-05   27.8  -1.7   15   33-47     14-28  (47)
 22 PF07543 PGA2:  Protein traffic  43.1     3.9 8.5E-05   32.1  -1.7   11   34-44     23-33  (140)
 23 PF02919 Topoisom_I_N:  Eukaryo  41.9      24 0.00052   30.0   2.7   34  105-138    89-122 (215)
 24 PHA00406 hypothetical protein   40.9      20 0.00044   24.3   1.7   20   19-38      8-27  (48)
 25 PF05337 CSF-1:  Macrophage col  39.9     9.6 0.00021   33.7   0.0   26   23-48    230-255 (285)
 26 PF11084 DUF2621:  Protein of u  39.4     8.5 0.00018   31.0  -0.4   30   21-50      9-38  (141)
 27 PRK07021 fliL flagellar basal   37.9      18 0.00039   28.1   1.2   25  108-132   109-133 (162)
 28 COG3645 Uncharacterized phage-  36.5      21 0.00045   28.5   1.4   16  103-118    60-75  (135)
 29 PF11337 DUF3139:  Protein of u  35.9      16 0.00035   25.5   0.7   23   18-40      1-25  (85)
 30 COG2229 Predicted GTPase [Gene  34.4      23  0.0005   29.6   1.4   22   19-42     79-100 (187)
 31 PRK12785 fliL flagellar basal   31.0      56  0.0012   25.6   3.0   20   24-43     30-49  (166)
 32 PRK10927 essential cell divisi  30.6 1.4E+02   0.003   26.9   5.7   17  101-117   115-131 (319)
 33 PF11239 DUF3040:  Protein of u  28.5      37 0.00081   23.6   1.5   11   98-108     2-12  (82)
 34 PHA03185 UL14 tegument protein  26.6      49  0.0011   28.4   2.1   24   99-122   141-164 (214)
 35 PF04375 HemX:  HemX;  InterPro  26.5      42 0.00091   29.4   1.7   14   27-40     37-50  (372)
 36 COG4698 Uncharacterized protei  26.0      34 0.00073   29.0   1.0   30   14-43      4-33  (197)
 37 KOG3088 Secretory carrier memb  25.9 1.7E+02  0.0036   26.5   5.3   41  103-148    65-105 (313)
 38 COG0522 RpsD Ribosomal protein  25.8      75  0.0016   26.4   3.0   34  107-146    48-81  (205)
 39 PF09328 Phytochelatin_C:  Doma  25.3      55  0.0012   28.8   2.2   37  103-139    54-93  (264)
 40 PF14108 DUF4281:  Domain of un  24.8      20 0.00043   27.4  -0.5   24   24-47     82-105 (129)
 41 COG5423 Predicted metal-bindin  23.6      61  0.0013   26.8   2.1   14  101-114    84-97  (167)
 42 PF13532 2OG-FeII_Oxy_2:  2OG-F  23.4      74  0.0016   23.9   2.4   16   99-114     9-24  (194)
 43 PF10883 DUF2681:  Protein of u  23.1      22 0.00048   26.3  -0.5   25   24-48      6-30  (87)
 44 PF11118 DUF2627:  Protein of u  23.1      79  0.0017   23.3   2.3   34   16-49     38-71  (77)
 45 PF13801 Metal_resist:  Heavy-m  22.7      28 0.00062   23.4   0.0   22   97-118    40-61  (125)
 46 KOG3204 60S ribosomal protein   21.9      35 0.00076   28.8   0.4   17  111-127   149-165 (197)
 47 PF13807 GNVR:  G-rich domain o  21.7      92   0.002   21.3   2.4   32    1-36     44-75  (82)
 48 PRK14746 RepA leader peptide T  21.4      42 0.00091   20.3   0.6   15   23-37      8-22  (26)
 49 PF11069 DUF2870:  Protein of u  21.4   1E+02  0.0022   23.5   2.7   15   98-112    46-60  (98)
 50 COG2411 Uncharacterized conser  20.6      58  0.0013   27.4   1.4   16  130-145   140-155 (188)
 51 PF11898 DUF3418:  Domain of un  20.3      65  0.0014   30.5   1.8   29  102-130   546-580 (586)
 52 PF07242 DUF1430:  Protein of u  20.3      74  0.0016   22.8   1.7   29   16-44     35-63  (100)
 53 PF03580 Herpes_UL14:  Herpesvi  20.3      46 0.00099   27.0   0.7   17   99-115   133-149 (149)

No 1  
>PF11169 DUF2956:  Protein of unknown function (DUF2956);  InterPro: IPR021339  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=73.54  E-value=1.3  Score=34.03  Aligned_cols=24  Identities=25%  Similarity=0.466  Sum_probs=20.0

Q ss_pred             hhhhhhHHHHHHHHHhhcceeeee
Q 032019           18 IRRYKPIWRILLISNLALGGYMFA   41 (148)
Q Consensus        18 ~rRYK~iwp~LLavNL~vGaYlF~   41 (148)
                      .+...+=|.+|+++=+|+++|+||
T Consensus        80 ~~~~~LPW~LL~lSW~gF~~Y~~~  103 (103)
T PF11169_consen   80 SRSSWLPWGLLVLSWIGFIAYIFM  103 (103)
T ss_pred             ccccchhHHHHHHHHHHHHHHHHC
Confidence            344456899999999999999986


No 2  
>PF14147 Spore_YhaL:  Sporulation protein YhaL
Probab=66.00  E-value=1.1  Score=30.79  Aligned_cols=27  Identities=26%  Similarity=0.639  Sum_probs=23.6

Q ss_pred             HHHHHHHHHhhcceeeeeeeeccchhh
Q 032019           24 IWRILLISNLALGGYMFAKARKKNSRV   50 (148)
Q Consensus        24 iwp~LLavNL~vGaYlF~rtkkkd~~~   50 (148)
                      .|-.|+++-+.+.|||+++|-+.+...
T Consensus         3 wWvY~vi~gI~~S~ym~v~t~~eE~~~   29 (52)
T PF14147_consen    3 WWVYFVIAGIIFSGYMAVKTAKEEREI   29 (52)
T ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            689999999999999999998776544


No 3  
>KOG3727 consensus Mitogen inducible gene product (contains ERM and PH domains) [Cell cycle control, cell division, chromosome partitioning]
Probab=62.30  E-value=3.7  Score=39.65  Aligned_cols=21  Identities=29%  Similarity=0.632  Sum_probs=18.1

Q ss_pred             HHHhhcceeeeeeeeccchhh
Q 032019           30 ISNLALGGYMFAKARKKNSRV   50 (148)
Q Consensus        30 avNL~vGaYlF~rtkkkd~~~   50 (148)
                      +|.=+||||+|+.||-||+.+
T Consensus       629 VVHEfIGGYIFLStRsKd~ne  649 (664)
T KOG3727|consen  629 VVHEFIGGYIFLSTRSKDQNE  649 (664)
T ss_pred             hhhhhccceEEEEecchhccc
Confidence            355689999999999999876


No 4  
>PF09911 DUF2140:  Uncharacterized protein conserved in bacteria (DUF2140);  InterPro: IPR018672  This family of conserved hypothetical proteins has no known function. 
Probab=59.78  E-value=6.6  Score=31.60  Aligned_cols=27  Identities=30%  Similarity=0.269  Sum_probs=21.9

Q ss_pred             hhhHHHHHHHHHhhcceeeeeeeeccc
Q 032019           21 YKPIWRILLISNLALGGYMFAKARKKN   47 (148)
Q Consensus        21 YK~iwp~LLavNL~vGaYlF~rtkkkd   47 (148)
                      .|..|-.||++||++++++|++--.-.
T Consensus         3 WK~aF~~Lla~~l~~~~~~~~~~~~~~   29 (187)
T PF09911_consen    3 WKWAFLILLALNLAFVIVVFFRLFQPS   29 (187)
T ss_pred             HHHHHHHHHHHHHHHHhheeeEEEccC
Confidence            456888899999999999998865444


No 5  
>PF08078 PsaX:  PsaX family;  InterPro: IPR012986 This family consists of the PsaX family of photosystem I (PSI) protein subunits. PSI is a large multi-subunit pigment protein complex embedded in the thylakoid membranes of green plants and cyanobacteria. PsaX is one of the 12 protein subunits found in PSI and these subunits are arranged as monomers or trimers within the membrane as shown by the structure of the trimeric complex from Synechococcus elongatus [].; PDB: 3PCQ_X 1JB0_X.
Probab=57.45  E-value=4.9  Score=25.96  Aligned_cols=21  Identities=29%  Similarity=0.746  Sum_probs=15.5

Q ss_pred             hhhhHHH-HHHHHHhhcceeee
Q 032019           20 RYKPIWR-ILLISNLALGGYMF   40 (148)
Q Consensus        20 RYK~iwp-~LLavNL~vGaYlF   40 (148)
                      -||..|- +||+.|+-|+||-|
T Consensus        13 ~frt~Wa~llLaINflVAayYF   34 (37)
T PF08078_consen   13 TFRTGWALLLLAINFLVAAYYF   34 (37)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHH
T ss_pred             ehhHHHHHHHHHHHHHHHHHHh
Confidence            3555676 46788999999987


No 6  
>PF14283 DUF4366:  Domain of unknown function (DUF4366)
Probab=57.10  E-value=16  Score=30.53  Aligned_cols=34  Identities=24%  Similarity=0.325  Sum_probs=19.9

Q ss_pred             hhhhhhhhhhHHHHHHHHHhhcceeeeeeeeccchhh
Q 032019           14 KESLIRRYKPIWRILLISNLALGGYMFAKARKKNSRV   50 (148)
Q Consensus        14 K~~f~rRYK~iwp~LLavNL~vGaYlF~rtkkkd~~~   50 (148)
                      |.+=|--   +.-+||++=+|.|||.+++-+|+....
T Consensus       156 kks~~g~---ll~lllv~l~gGGa~yYfK~~K~K~~~  189 (218)
T PF14283_consen  156 KKSGMGS---LLLLLLVALIGGGAYYYFKFYKPKQEE  189 (218)
T ss_pred             cccchHH---HHHHHHHHHhhcceEEEEEEecccccc
Confidence            4444444   333334444788888888777765544


No 7  
>PF15012 DUF4519:  Domain of unknown function (DUF4519)
Probab=56.25  E-value=6.3  Score=27.39  Aligned_cols=25  Identities=16%  Similarity=0.218  Sum_probs=22.1

Q ss_pred             hhHHHHHHHHHhhcceeeeeeeecc
Q 032019           22 KPIWRILLISNLALGGYMFAKARKK   46 (148)
Q Consensus        22 K~iwp~LLavNL~vGaYlF~rtkkk   46 (148)
                      ..+.|.|.++=++|.+|+++.|+++
T Consensus        32 tVVlP~l~~~~~~Ivv~vy~kTRP~   56 (56)
T PF15012_consen   32 TVVLPTLAAVFLFIVVFVYLKTRPR   56 (56)
T ss_pred             eEehhHHHHHHHHHhheeEEeccCC
Confidence            3478999999999999999999864


No 8  
>cd03489 Topoisomer_IB_N_LdtopoI_like Topoisomer_IB_N_LdtopoI_like: N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB proteins similar to the heterodimeric topo I from Leishmania donvanni. Topo I enzymes are divided into:  topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes.  Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit re-ligation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts. In addition to differences in structure and some biochemical properties, Trypanosomatid parasite topo I differ from human
Probab=55.87  E-value=11  Score=32.06  Aligned_cols=34  Identities=35%  Similarity=0.585  Sum_probs=29.1

Q ss_pred             HHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHH
Q 032019          105 RELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQ  138 (148)
Q Consensus       105 rel~KWiLEEKRKikpkd~~EKkridEeKalLK~  138 (148)
                      ..+|.|..++|-+-|-...+||++|-+||.-+.+
T Consensus        85 ~~i~~~~~~~~e~kK~~tkeEKk~~K~ek~~~e~  118 (212)
T cd03489          85 TPIYEWHLREKEKKKSRTKEEKKALKEEKDKEAE  118 (212)
T ss_pred             HHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhc
Confidence            4689999999888888999999999999976653


No 9  
>PRK10819 transport protein TonB; Provisional
Probab=55.04  E-value=19  Score=30.27  Aligned_cols=17  Identities=41%  Similarity=0.557  Sum_probs=7.8

Q ss_pred             hhhhhhhHHHHHH--HHHhhc
Q 032019           17 LIRRYKPIWRILL--ISNLAL   35 (148)
Q Consensus        17 f~rRYK~iwp~LL--avNL~v   35 (148)
                      ++||+  .|.+++  ++-++|
T Consensus         8 l~rr~--~~~li~Sv~lH~al   26 (246)
T PRK10819          8 LPRRF--PWPTLLSVGLHGAV   26 (246)
T ss_pred             hhhhH--HHHHHHHHHHHHHH
Confidence            45554  454444  343344


No 10 
>PF14163 SieB:  Superinfection exclusion protein B
Probab=54.08  E-value=9.1  Score=28.99  Aligned_cols=14  Identities=43%  Similarity=0.631  Sum_probs=12.6

Q ss_pred             hHHHHHHHHHHhhc
Q 032019          130 DEEKAILKQFIRAE  143 (148)
Q Consensus       130 dEeKalLK~fIRak  143 (148)
                      .+|||+|.+|++++
T Consensus        81 ~~EkavL~~~~~~~   94 (151)
T PF14163_consen   81 PEEKAVLREFYIQG   94 (151)
T ss_pred             HHHHHHHHHHHHCC
Confidence            47999999999987


No 11 
>cd00660 Topoisomer_IB_N Topoisomer_IB_N: N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB proteins similar to the monomeric yeast and human topo I and heterodimeric topo I from Leishmania donvanni. Topo I enzymes are divided into:  topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes.  Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit re-ligation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts.  In addition to differences in structure and some biochemical properties, Trypanosomatid parasite topo I diffe
Probab=54.05  E-value=12  Score=31.89  Aligned_cols=34  Identities=38%  Similarity=0.546  Sum_probs=29.3

Q ss_pred             HHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHH
Q 032019          105 RELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQ  138 (148)
Q Consensus       105 rel~KWiLEEKRKikpkd~~EKkridEeKalLK~  138 (148)
                      ..+|.|..++|-+-|-...+||++|-+||.-+.+
T Consensus        88 ~~i~~~~~~~~e~kK~~s~eEKk~~K~ek~~~e~  121 (215)
T cd00660          88 TPIYQYFEEEKEKKKAMSKEEKKAIKEEKEKLEE  121 (215)
T ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhc
Confidence            5689999999888888999999999999976653


No 12 
>cd03490 Topoisomer_IB_N_1 Topoisomer_IB_N_1: A subgroup of the N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB. Topo IB proteins include the monomeric yeast and human topo I and heterodimeric topo I from Leishmania donvanni. Topo I enzymes are divided into:  topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes.  Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit religation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts.  In addition to differences in structure and some biochemical properties, Trypanoso
Probab=52.89  E-value=13  Score=31.79  Aligned_cols=34  Identities=26%  Similarity=0.224  Sum_probs=29.0

Q ss_pred             HHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHH
Q 032019          105 RELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQ  138 (148)
Q Consensus       105 rel~KWiLEEKRKikpkd~~EKkridEeKalLK~  138 (148)
                      ..+|.|..++|-+-|-...+||++|-+||.-+.+
T Consensus        87 ~~i~~~~~~~ke~kK~~tkeEKk~~K~ek~~~e~  120 (217)
T cd03490          87 SLIKNHLEEEKEKKKNLNKEEKEAKKKERAKREY  120 (217)
T ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhc
Confidence            5689999999888888899999999999876553


No 13 
>cd03488 Topoisomer_IB_N_htopoI_like Topoisomer_IB_N_htopoI_like : N-terminal DNA binding fragment found in eukaryotic DNA topoisomerase (topo) IB proteins similar to the monomeric yeast and human topo I.  Topo I enzymes are divided into:  topo type IA (bacterial) and type IB (eukaryotic). Topo I relaxes superhelical tension in duplex DNA by creating a single-strand nick, the broken strand can then rotate around the unbroken strand to remove DNA supercoils and, the nick is religated, liberating topo I. These enzymes regulate the topological changes that accompany DNA replication, transcription and other nuclear processes.  Human topo I is the target of a diverse set of anticancer drugs including camptothecins (CPTs). CPTs bind to the topo I-DNA complex and inhibit religation of the single-strand nick, resulting in the accumulation of topo I-DNA adducts.  This family may represent more than one structural domain.
Probab=52.36  E-value=13  Score=31.60  Aligned_cols=34  Identities=29%  Similarity=0.466  Sum_probs=29.3

Q ss_pred             HHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHH
Q 032019          105 RELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQ  138 (148)
Q Consensus       105 rel~KWiLEEKRKikpkd~~EKkridEeKalLK~  138 (148)
                      ..+|.|..++|-+-|-...+||++|-+||.-+.+
T Consensus        88 ~~i~~~~~~~~e~kK~~tkeEKk~~K~ek~~~e~  121 (215)
T cd03488          88 TQMFAYFKAQKEEKKAMSKEEKKAIKAEKEKLEE  121 (215)
T ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhhc
Confidence            5689999999888888999999999999976553


No 14 
>PRK14745 RepA leader peptide Tap; Provisional
Probab=51.79  E-value=8.4  Score=23.20  Aligned_cols=16  Identities=31%  Similarity=0.694  Sum_probs=13.9

Q ss_pred             hhhHHHHHHHHHhhcc
Q 032019           21 YKPIWRILLISNLALG   36 (148)
Q Consensus        21 YK~iwp~LLavNL~vG   36 (148)
                      |-|+|-+||..|+..|
T Consensus         7 ylfl~hlllpcnisag   22 (26)
T PRK14745          7 YLFLWHLLLPCIVSAG   22 (26)
T ss_pred             HHHHHHHHhhcccccc
Confidence            6788999999999876


No 15 
>PF14854 LURAP:  Leucine rich adaptor protein 
Probab=49.19  E-value=13  Score=29.38  Aligned_cols=19  Identities=26%  Similarity=0.639  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHhhhcCCC
Q 032019          102 DQQRELFKWILEEKRKVKP  120 (148)
Q Consensus       102 DeQrel~KWiLEEKRKikp  120 (148)
                      +|=.|=||||+|||=-+-.
T Consensus        49 NEsIe~~KWlmEEr~~l~s   67 (121)
T PF14854_consen   49 NESIEEVKWLMEERGALTS   67 (121)
T ss_pred             HhhHHHHHHHHHHhhcccC
Confidence            4556779999999865543


No 16 
>PF14164 YqzH:  YqzH-like protein
Probab=48.97  E-value=19  Score=25.47  Aligned_cols=22  Identities=32%  Similarity=0.481  Sum_probs=19.0

Q ss_pred             cCCCCHHHHHHHHHHHHHhhhc
Q 032019           96 REPIPEDQQRELFKWILEEKRK  117 (148)
Q Consensus        96 ~~PIpeDeQrel~KWiLEEKRK  117 (148)
                      .-|++.+||++|++-|.+.|-+
T Consensus        23 ~~pls~~E~~~L~~~i~~~~~~   44 (64)
T PF14164_consen   23 CMPLSDEEWEELCKHIQERKNE   44 (64)
T ss_pred             CCCCCHHHHHHHHHHHHHHHhc
Confidence            5689999999999999987743


No 17 
>PRK12757 cell division protein FtsN; Provisional
Probab=48.00  E-value=91  Score=27.04  Aligned_cols=17  Identities=29%  Similarity=0.556  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHhhhc
Q 032019          101 EDQQRELFKWILEEKRK  117 (148)
Q Consensus       101 eDeQrel~KWiLEEKRK  117 (148)
                      -||||+|+.=|-.++|-
T Consensus        81 t~Eqrqlleqmq~Dmrq   97 (256)
T PRK12757         81 TDEQRQLLEQMQADMRQ   97 (256)
T ss_pred             CHHHHHHHHHHHHHHhc
Confidence            47999999999999993


No 18 
>TIGR02223 ftsN cell division protein FtsN. FtsN is a poorly conserved protein active in cell division in a number of Proteobacteria. The N-terminal 30 residue region tends to by Lys/Arg-rich, and is followed by a membrane-spanning region. This is followed by an acidic low-complexity region of variable length and a well-conserved C-terminal domain of two tandem regions matched by Pfam model pfam05036 (Sporulation related repeat), found in several cell division and sporulation proteins. The role of FtsN as a suppressor for other cell division mutations is poorly understood; it may involve cell wall hydrolysis.
Probab=46.96  E-value=1.2e+02  Score=26.34  Aligned_cols=17  Identities=24%  Similarity=0.425  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHhhhcC
Q 032019          102 DQQRELFKWILEEKRKV  118 (148)
Q Consensus       102 DeQrel~KWiLEEKRKi  118 (148)
                      +|||+|+.=|.++.|.-
T Consensus       116 ~eq~q~leq~~~d~r~~  132 (298)
T TIGR02223       116 AEQRQLLEQMQADMRAA  132 (298)
T ss_pred             HHHHHHHHHHHHHHhhh
Confidence            59999999999999843


No 19 
>TIGR03475 tap_IncFII_lead RepA leader peptide Tap. This protein is a translated leader peptide that actis in the regulation of the expression of the plasmid replication protein RepA in incF2 group plasmids.
Probab=46.14  E-value=13  Score=22.46  Aligned_cols=17  Identities=29%  Similarity=0.485  Sum_probs=14.4

Q ss_pred             hhhHHHHHHHHHhhcce
Q 032019           21 YKPIWRILLISNLALGG   37 (148)
Q Consensus        21 YK~iwp~LLavNL~vGa   37 (148)
                      |-|+|.+||..|+.-|.
T Consensus         7 ~~FLc~~LL~cniSAg~   23 (26)
T TIGR03475         7 YLFLCHLLLPCNISAGR   23 (26)
T ss_pred             HHHHHHHHhhhcccccc
Confidence            66899999999998774


No 20 
>PF08048 RepA1_leader:  Tap RepA1 leader peptide;  InterPro: IPR012605 This entry represents of the RepA1 leader peptide known as Tap found in IncFII plasmids. The frequency of replication of IncFII plasmid NR1 during the cell division cycle is regulated by the control of the synthesis of the plasmid-specific replication initiation protein (RepA1). When RepA1 is synthesised, it binds to the plasmid replication origin (ori) and effects the assembly of a replication complex composed of host proteins that mediate the replication of the plasmid [, ]. The tap gene encodes a 24-amino acid peptide whose translation is required for the translation of repA.
Probab=45.78  E-value=14  Score=22.07  Aligned_cols=17  Identities=29%  Similarity=0.485  Sum_probs=14.2

Q ss_pred             hhhHHHHHHHHHhhcce
Q 032019           21 YKPIWRILLISNLALGG   37 (148)
Q Consensus        21 YK~iwp~LLavNL~vGa   37 (148)
                      |-|+|-+||..|+.-|.
T Consensus         7 ~~FLc~lLL~CniSAg~   23 (25)
T PF08048_consen    7 YLFLCHLLLPCNISAGR   23 (25)
T ss_pred             HHHHHHHHhhhhccccc
Confidence            56899999999998773


No 21 
>PF15055 DUF4536:  Domain of unknown function (DUF4536)
Probab=44.62  E-value=3.2  Score=27.79  Aligned_cols=15  Identities=40%  Similarity=0.853  Sum_probs=12.9

Q ss_pred             hhcceeeeeeeeccc
Q 032019           33 LALGGYMFAKARKKN   47 (148)
Q Consensus        33 L~vGaYlF~rtkkkd   47 (148)
                      +|+|+|||+-+||.-
T Consensus        14 ig~G~Yv~~~ark~~   28 (47)
T PF15055_consen   14 IGAGAYVYAQARKRM   28 (47)
T ss_pred             HHHHHHHHHHHhhcc
Confidence            689999999988864


No 22 
>PF07543 PGA2:  Protein trafficking PGA2;  InterPro: IPR011431 A Saccharomyces cerevisiae (Baker's yeast) member of this family (PGA2, P53903 from SWISSPROT) is a single pass membrane protein which has been implicated in protein trafficking [, ].
Probab=43.13  E-value=3.9  Score=32.08  Aligned_cols=11  Identities=27%  Similarity=0.803  Sum_probs=9.4

Q ss_pred             hcceeeeeeee
Q 032019           34 ALGGYMFAKAR   44 (148)
Q Consensus        34 ~vGaYlF~rtk   44 (148)
                      -||||||.|.|
T Consensus        23 IVggYiLlRPY   33 (140)
T PF07543_consen   23 IVGGYILLRPY   33 (140)
T ss_pred             hhhHHHHHHHH
Confidence            47999999975


No 23 
>PF02919 Topoisom_I_N:  Eukaryotic DNA topoisomerase I, DNA binding fragment;  InterPro: IPR008336 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the N-terminal DNA-binding domain found in eukaryotic topoisomerase I, which is a type IB enzymes. To cleave the DNA backbone, these enzymes must make a transient phosphotyrosine bond. The N-terminal domain of human topoisomerase I is thought to coordinate the restriction of free strand rotation during the topoisomerisation step of catalysis. A conserved tryptophan residue may be important for the DNA-interaction ability of the N-terminal domain []. Human topoisomerase I has been shown to be inhibited by camptothecin (CPT), a plant alkaloid with antitumour activity. A binding mode for the anticancer drug camptothecin has been proposed on the basis of chemical and biochemical information combined with the three-dimensional structures of topoisomerase I-DNA complexes []. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003917 DNA topoisomerase type I activity, 0006265 DNA topological change, 0005694 chromosome; PDB: 1TL8_A 1K4T_A 1A36_A 1RR8_C 1T8I_A 1SC7_A 1EJ9_A 1LPQ_A 1RRJ_A 1A31_A ....
Probab=41.89  E-value=24  Score=30.05  Aligned_cols=34  Identities=32%  Similarity=0.490  Sum_probs=28.1

Q ss_pred             HHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHH
Q 032019          105 RELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQ  138 (148)
Q Consensus       105 rel~KWiLEEKRKikpkd~~EKkridEeKalLK~  138 (148)
                      +.+|.|..++|-+-|-...+||+++-+|++-|.+
T Consensus        89 ~~i~~~~~~~~e~kk~~skeEK~~~K~~k~~~~~  122 (215)
T PF02919_consen   89 SPIYEYFEKEKEKKKNMSKEEKKALKEEKEELEE  122 (215)
T ss_dssp             HHHHHHHHHHHHHHCTS-CCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHh
Confidence            5789999988888888889999999999987765


No 24 
>PHA00406 hypothetical protein
Probab=40.86  E-value=20  Score=24.32  Aligned_cols=20  Identities=35%  Similarity=0.413  Sum_probs=16.9

Q ss_pred             hhhhhHHHHHHHHHhhccee
Q 032019           19 RRYKPIWRILLISNLALGGY   38 (148)
Q Consensus        19 rRYK~iwp~LLavNL~vGaY   38 (148)
                      -|+|.-|+||+++-.++|.-
T Consensus         8 ~~hRvTyrFL~vlaaalG~a   27 (48)
T PHA00406          8 LRHRVTYRFLLVLAAALGYA   27 (48)
T ss_pred             HHhHHHHHHHHHHHHHhhHH
Confidence            47889999999998888854


No 25 
>PF05337 CSF-1:  Macrophage colony stimulating factor-1 (CSF-1);  InterPro: IPR008001 Colony stimulating factor 1 (CSF-1) is a homodimeric polypeptide growth factor whose primary function is to regulate the survival, proliferation, differentiation, and function of cells of the mononuclear phagocytic lineage. This lineage includes mononuclear phagocytic precursors, blood monocytes, tissue macrophages, osteoclasts, and microglia of the brain, all of which possess cell surface receptors for CSF-1. The protein has also been linked with male fertility [] and mutations in the Csf-1 gene have been found to cause osteopetrosis and failure of tooth eruption [].; GO: 0005125 cytokine activity, 0008083 growth factor activity, 0016021 integral to membrane; PDB: 3EJJ_A.
Probab=39.90  E-value=9.6  Score=33.70  Aligned_cols=26  Identities=23%  Similarity=0.533  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHhhcceeeeeeeeccch
Q 032019           23 PIWRILLISNLALGGYMFAKARKKNS   48 (148)
Q Consensus        23 ~iwp~LLavNL~vGaYlF~rtkkkd~   48 (148)
                      ++.|-+++|=|+||+.+|+|.|.+.-
T Consensus       230 lLVPSiILVLLaVGGLLfYr~rrRs~  255 (285)
T PF05337_consen  230 LLVPSIILVLLAVGGLLFYRRRRRSH  255 (285)
T ss_dssp             --------------------------
T ss_pred             ccccchhhhhhhccceeeeccccccc
Confidence            57888889999999999999988764


No 26 
>PF11084 DUF2621:  Protein of unknown function (DUF2621);  InterPro: IPR020203 This entry represents a group of uncharacterised proteins.
Probab=39.37  E-value=8.5  Score=31.04  Aligned_cols=30  Identities=23%  Similarity=0.525  Sum_probs=22.6

Q ss_pred             hhhHHHHHHHHHhhcceeeeeeeeccchhh
Q 032019           21 YKPIWRILLISNLALGGYMFAKARKKNSRV   50 (148)
Q Consensus        21 YK~iwp~LLavNL~vGaYlF~rtkkkd~~~   50 (148)
                      +=+.|.++|++=++||||..+|.-=|--.+
T Consensus         9 fI~~W~~vli~l~~IGGfFMFRKFLK~lPK   38 (141)
T PF11084_consen    9 FILFWVVVLIGLMAIGGFFMFRKFLKRLPK   38 (141)
T ss_pred             HHHHHHHHHHHHHHHhHHHHHHHHHHhCCc
Confidence            345899999999999999877765444333


No 27 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=37.94  E-value=18  Score=28.05  Aligned_cols=25  Identities=16%  Similarity=0.295  Sum_probs=12.4

Q ss_pred             HHHHHHhhhcCCCCChHhhhhchHH
Q 032019          108 FKWILEEKRKVKPKDPKEKKRIDEE  132 (148)
Q Consensus       108 ~KWiLEEKRKikpkd~~EKkridEe  132 (148)
                      +--+|-+|+--.-.+.+-|.++-+|
T Consensus       109 ii~~Ls~k~~~~L~~~eGk~~Lk~e  133 (162)
T PRK07021        109 LLLLLSRKHAAELATEEGKQKLAAE  133 (162)
T ss_pred             HHHHHhcCCHHHhcCHHHHHHHHHH
Confidence            3334545544444455555555544


No 28 
>COG3645 Uncharacterized phage-encoded protein [Function unknown]
Probab=36.47  E-value=21  Score=28.52  Aligned_cols=16  Identities=31%  Similarity=0.702  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHHhhhcC
Q 032019          103 QQRELFKWILEEKRKV  118 (148)
Q Consensus       103 eQrel~KWiLEEKRKi  118 (148)
                      -|++||.||+|++==+
T Consensus        60 ge~~l~~~L~e~~~l~   75 (135)
T COG3645          60 GENRLFAWLRENKYLI   75 (135)
T ss_pred             CHHHHHHHHHHCCEEE
Confidence            4789999999986433


No 29 
>PF11337 DUF3139:  Protein of unknown function (DUF3139);  InterPro: IPR021486  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=35.92  E-value=16  Score=25.53  Aligned_cols=23  Identities=26%  Similarity=0.540  Sum_probs=15.8

Q ss_pred             hhhhhhHHHHHHHHHh--hcceeee
Q 032019           18 IRRYKPIWRILLISNL--ALGGYMF   40 (148)
Q Consensus        18 ~rRYK~iwp~LLavNL--~vGaYlF   40 (148)
                      |+++|.+|-+|++.-+  ++|.++|
T Consensus         1 MKK~kii~iii~li~i~li~~~~~~   25 (85)
T PF11337_consen    1 MKKKKIILIIIILIVISLIIGIYYF   25 (85)
T ss_pred             CCchHHHHHHHHHHHHHHHHHHHHh
Confidence            6788998887666654  4565555


No 30 
>COG2229 Predicted GTPase [General function prediction only]
Probab=34.40  E-value=23  Score=29.58  Aligned_cols=22  Identities=32%  Similarity=0.688  Sum_probs=17.0

Q ss_pred             hhhhhHHHHHHHHHhhcceeeeee
Q 032019           19 RRYKPIWRILLISNLALGGYMFAK   42 (148)
Q Consensus        19 rRYK~iwp~LLavNL~vGaYlF~r   42 (148)
                      .||+|||-.|+=-  ++|+-+|+-
T Consensus        79 ~RF~fm~~~l~~g--a~gaivlVD  100 (187)
T COG2229          79 ERFKFMWEILSRG--AVGAIVLVD  100 (187)
T ss_pred             HHHHHHHHHHhCC--cceEEEEEe
Confidence            6999999987655  777777763


No 31 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=30.96  E-value=56  Score=25.65  Aligned_cols=20  Identities=20%  Similarity=0.255  Sum_probs=13.9

Q ss_pred             HHHHHHHHHhhcceeeeeee
Q 032019           24 IWRILLISNLALGGYMFAKA   43 (148)
Q Consensus        24 iwp~LLavNL~vGaYlF~rt   43 (148)
                      +..+||++=.|.|+|+|+..
T Consensus        30 ~~~~lll~~~g~g~~f~~~~   49 (166)
T PRK12785         30 AAAAVLLLGGGGGGFFFFFS   49 (166)
T ss_pred             HHHHHHHHhcchheEEEEEe
Confidence            34455566667789999876


No 32 
>PRK10927 essential cell division protein FtsN; Provisional
Probab=30.60  E-value=1.4e+02  Score=26.93  Aligned_cols=17  Identities=24%  Similarity=0.450  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHHHhhhc
Q 032019          101 EDQQRELFKWILEEKRK  117 (148)
Q Consensus       101 eDeQrel~KWiLEEKRK  117 (148)
                      -||||+|+.=|-.++|-
T Consensus       115 T~EQrQlLeqmqaDmrq  131 (319)
T PRK10927        115 TPEQRQLLEQMQADMRQ  131 (319)
T ss_pred             CHHHHHHHHHHHHHHhc
Confidence            46999999999999993


No 33 
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=28.52  E-value=37  Score=23.62  Aligned_cols=11  Identities=45%  Similarity=0.739  Sum_probs=8.8

Q ss_pred             CCCHHHHHHHH
Q 032019           98 PIPEDQQRELF  108 (148)
Q Consensus        98 PIpeDeQrel~  108 (148)
                      |+||+|||.|-
T Consensus         2 ~LSe~E~r~L~   12 (82)
T PF11239_consen    2 PLSEHEQRRLE   12 (82)
T ss_pred             CCCHHHHHHHH
Confidence            78999999553


No 34 
>PHA03185 UL14 tegument protein; Provisional
Probab=26.61  E-value=49  Score=28.36  Aligned_cols=24  Identities=25%  Similarity=0.529  Sum_probs=20.5

Q ss_pred             CCHHHHHHHHHHHHHhhhcCCCCC
Q 032019           99 IPEDQQRELFKWILEEKRKVKPKD  122 (148)
Q Consensus        99 IpeDeQrel~KWiLEEKRKikpkd  122 (148)
                      ..|++--=|-+||||++=||.|..
T Consensus       141 l~e~DEaLLt~W~Le~aP~v~~~~  164 (214)
T PHA03185        141 MSPEDSDLLIMWQLGSAPAVRPGD  164 (214)
T ss_pred             ccccHHHHHHHHHHhcCCCCCCCC
Confidence            667777889999999999998775


No 35 
>PF04375 HemX:  HemX;  InterPro: IPR007470 The majority of proteins in this family are annotated as uroporphyrin-III C-methyltransferase (2.1.1.107 from EC) []; however, there is no direct evidence to support this annotation for these proteins, which come from mainly pathogenic Gram-negative organisms. There is some evidence to suggest that the proteins are membrane anchored as they have a predicted N-terminal signal peptide and transmembrane domain and may be involved in haem transport []. 
Probab=26.48  E-value=42  Score=29.39  Aligned_cols=14  Identities=36%  Similarity=0.752  Sum_probs=7.1

Q ss_pred             HHHHHHhhcceeee
Q 032019           27 ILLISNLALGGYMF   40 (148)
Q Consensus        27 ~LLavNL~vGaYlF   40 (148)
                      +|+++=+|+|+|.|
T Consensus        37 lll~~alg~~~~~~   50 (372)
T PF04375_consen   37 LLLALALGAGGWYW   50 (372)
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444445556666


No 36 
>COG4698 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.03  E-value=34  Score=28.99  Aligned_cols=30  Identities=23%  Similarity=0.198  Sum_probs=22.6

Q ss_pred             hhhhhhhhhhHHHHHHHHHhhcceeeeeee
Q 032019           14 KESLIRRYKPIWRILLISNLALGGYMFAKA   43 (148)
Q Consensus        14 K~~f~rRYK~iwp~LLavNL~vGaYlF~rt   43 (148)
                      |++=+.-.|.+|-.|||.|..+.+|++++-
T Consensus         4 kk~~~n~WKw~f~iLLAln~l~~~~i~~~v   33 (197)
T COG4698           4 KKGTLNYWKWLFFILLALNTLLAVLIALFV   33 (197)
T ss_pred             ccccccHHHHHHHHHHHHHHHHHHHhheee
Confidence            444445567799999999998888877764


No 37 
>KOG3088 consensus Secretory carrier membrane protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=25.94  E-value=1.7e+02  Score=26.50  Aligned_cols=41  Identities=34%  Similarity=0.342  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHHhhhcCCCCChHhhhhchHHHHHHHHHHhhcCCCCC
Q 032019          103 QQRELFKWILEEKRKVKPKDPKEKKRIDEEKAILKQFIRAESIPQL  148 (148)
Q Consensus       103 eQrel~KWiLEEKRKikpkd~~EKkridEeKalLK~fIRaksiP~l  148 (148)
                      -|.||.+|=-|=+||     ++|=+|-.+|-+=+-+-||.+.-|.|
T Consensus        65 kq~eL~~rqeEL~Rk-----e~ELdRREr~~a~~g~~~~~nNWPPL  105 (313)
T KOG3088|consen   65 KQAELLKKQEELRRK-----EQELDRRERALARAGIVIRENNWPPL  105 (313)
T ss_pred             HHHHHHHHHHHHHHH-----HHHHhHHHHHHhhccCcccccCCCCC
Confidence            489999999999987     55666655666666677777776643


No 38 
>COG0522 RpsD Ribosomal protein S4 and related proteins [Translation, ribosomal structure and biogenesis]
Probab=25.78  E-value=75  Score=26.40  Aligned_cols=34  Identities=21%  Similarity=0.149  Sum_probs=29.1

Q ss_pred             HHHHHHHhhhcCCCCChHhhhhchHHHHHHHHHHhhcCCC
Q 032019          107 LFKWILEEKRKVKPKDPKEKKRIDEEKAILKQFIRAESIP  146 (148)
Q Consensus       107 l~KWiLEEKRKikpkd~~EKkridEeKalLK~fIRaksiP  146 (148)
                      .|.+.|.||||++.--.      ..|+.+++-|.+++-++
T Consensus        48 ~yg~qL~ekqkl~~~yg------~~ekqf~~~l~~a~~l~   81 (205)
T COG0522          48 DYGLQLREKQKLRAFYG------VLEKQFRRYLKEAGRLK   81 (205)
T ss_pred             HHHHHHHHHHHhhhhcc------HHHHHHHHHHHHHhccC
Confidence            58889999999999887      67888999888888765


No 39 
>PF09328 Phytochelatin_C:  Domain of unknown function (DUF1984);  InterPro: IPR015407 This entry represents the C-terminal region of plant phytochelatin synthases (also known as glutathione gamma-glutamylcysteinyltransferase; 2.3.2.15 from EC), which is involved in the synthesis of phytochelatins (PC) and homophytochelatins (hPC), the heavy-metal-binding peptides of plants. This enzyme is required for detoxification of heavy metals such as cadmium and arsenate. The N-terminal region of phytochelatin synthase contains the active site, as well as four highly conserved cysteine residues that appear to play an important role in heavy-metal-induced phytochelatin catalysis. The C-terminal region is rich in cysteines, and may act as a metal sensor, whereby the Cys residues bind cadmium ions to bring them into closer proximity and transferring them to the activation site in the N-terminal catalytic domain []. The C-terminal region displays homology to the functional domains of metallothionein and metallochaperone.; GO: 0016756 glutathione gamma-glutamylcysteinyltransferase activity, 0046872 metal ion binding, 0010038 response to metal ion, 0046938 phytochelatin biosynthetic process
Probab=25.28  E-value=55  Score=28.80  Aligned_cols=37  Identities=27%  Similarity=0.504  Sum_probs=30.0

Q ss_pred             HHHHHHHHHHHhhhcCCC---CChHhhhhchHHHHHHHHH
Q 032019          103 QQRELFKWILEEKRKVKP---KDPKEKKRIDEEKAILKQF  139 (148)
Q Consensus       103 eQrel~KWiLEEKRKikp---kd~~EKkridEeKalLK~f  139 (148)
                      .=+++.|||-|=||.-.-   =+.+||.|+.---.+|+|.
T Consensus        54 n~~~FIKWVaEVRR~Edg~~~LS~EEk~RL~lKe~VL~Qv   93 (264)
T PF09328_consen   54 NFGEFIKWVAEVRRQEDGGSSLSKEEKERLALKEEVLQQV   93 (264)
T ss_pred             hHHHHhhhheeEEecccCCCCCCHHHHHHHHHHHHHHHHH
Confidence            357899999999999776   4588999988777778874


No 40 
>PF14108 DUF4281:  Domain of unknown function (DUF4281)
Probab=24.83  E-value=20  Score=27.39  Aligned_cols=24  Identities=25%  Similarity=0.571  Sum_probs=20.3

Q ss_pred             HHHHHHHHHhhcceeeeeeeeccc
Q 032019           24 IWRILLISNLALGGYMFAKARKKN   47 (148)
Q Consensus        24 iwp~LLavNL~vGaYlF~rtkkkd   47 (148)
                      .|-=+|+.||+||.+++....++.
T Consensus        82 ~W~H~LafDLfvGrwi~~d~~~~g  105 (129)
T PF14108_consen   82 GWVHYLAFDLFVGRWIYLDARRRG  105 (129)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHcC
Confidence            799999999999999987665544


No 41 
>COG5423 Predicted metal-binding protein [Function unknown]
Probab=23.59  E-value=61  Score=26.84  Aligned_cols=14  Identities=21%  Similarity=0.454  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHh
Q 032019          101 EDQQRELFKWILEE  114 (148)
Q Consensus       101 eDeQrel~KWiLEE  114 (148)
                      +|||+..|.||||-
T Consensus        84 eeE~k~~~~~mlel   97 (167)
T COG5423          84 EEEKKRSLRKMLEL   97 (167)
T ss_pred             HHHHHHHHHHHHHH
Confidence            55789999999983


No 42 
>PF13532 2OG-FeII_Oxy_2:  2OG-Fe(II) oxygenase superfamily; PDB: 2IUW_A 3BTZ_A 3RZL_A 3RZH_A 3S5A_A 3RZG_A 3RZJ_A 3BUC_A 3H8X_A 3H8R_A ....
Probab=23.44  E-value=74  Score=23.86  Aligned_cols=16  Identities=25%  Similarity=0.437  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHHHHh
Q 032019           99 IPEDQQRELFKWILEE  114 (148)
Q Consensus        99 IpeDeQrel~KWiLEE  114 (148)
                      |+++||.+|+.++.++
T Consensus         9 ls~~e~~~l~~~l~~~   24 (194)
T PF13532_consen    9 LSEEEAAELLNELRES   24 (194)
T ss_dssp             S-HHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHhh
Confidence            7999999999999964


No 43 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=23.10  E-value=22  Score=26.25  Aligned_cols=25  Identities=16%  Similarity=0.084  Sum_probs=20.5

Q ss_pred             HHHHHHHHHhhcceeeeeeeeccch
Q 032019           24 IWRILLISNLALGGYMFAKARKKNS   48 (148)
Q Consensus        24 iwp~LLavNL~vGaYlF~rtkkkd~   48 (148)
                      +|..++++=++++||++.+.++--.
T Consensus         6 iv~~~~~v~~~i~~y~~~k~~ka~~   30 (87)
T PF10883_consen    6 IVGGVGAVVALILAYLWWKVKKAKK   30 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            6778888899999999999876443


No 44 
>PF11118 DUF2627:  Protein of unknown function (DUF2627);  InterPro: IPR020138 This entry represents uncharacterised membrane proteins with no known function.
Probab=23.06  E-value=79  Score=23.25  Aligned_cols=34  Identities=21%  Similarity=0.318  Sum_probs=22.5

Q ss_pred             hhhhhhhhHHHHHHHHHhhcceeeeeeeeccchh
Q 032019           16 SLIRRYKPIWRILLISNLALGGYMFAKARKKNSR   49 (148)
Q Consensus        16 ~f~rRYK~iwp~LLavNL~vGaYlF~rtkkkd~~   49 (148)
                      +++-.+=.+.-+.++-=-++|+|+|.|-||++.-
T Consensus        38 ~lwlqfl~G~~lf~~G~~Fi~GfI~~RDRKrnkV   71 (77)
T PF11118_consen   38 SLWLQFLAGLLLFAIGVGFIAGFILHRDRKRNKV   71 (77)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHhHhheeecccccc
Confidence            4444444444444455567899999999998753


No 45 
>PF13801 Metal_resist:  Heavy-metal resistance; PDB: 3EPV_C 2Y3D_A 2Y3H_D 2Y3G_B 2Y3B_A 2Y39_A 3LAY_H.
Probab=22.66  E-value=28  Score=23.39  Aligned_cols=22  Identities=18%  Similarity=0.188  Sum_probs=14.8

Q ss_pred             CCCCHHHHHHHHHHHHHhhhcC
Q 032019           97 EPIPEDQQRELFKWILEEKRKV  118 (148)
Q Consensus        97 ~PIpeDeQrel~KWiLEEKRKi  118 (148)
                      --++++||.+|..=+.+...++
T Consensus        40 l~Lt~eQ~~~l~~~~~~~~~~~   61 (125)
T PF13801_consen   40 LNLTPEQQAKLRALMDEFRQEM   61 (125)
T ss_dssp             S-TTHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCHHHHHHHHHHHHHHHHHH
Confidence            3588888888877776655543


No 46 
>KOG3204 consensus 60S ribosomal protein L13a [Translation, ribosomal structure and biogenesis]
Probab=21.87  E-value=35  Score=28.81  Aligned_cols=17  Identities=59%  Similarity=0.542  Sum_probs=13.3

Q ss_pred             HHHhhhcCCCCChHhhh
Q 032019          111 ILEEKRKVKPKDPKEKK  127 (148)
Q Consensus       111 iLEEKRKikpkd~~EKk  127 (148)
                      =||||||.|.+..-.||
T Consensus       149 tLEeKRKeK~~~~y~kK  165 (197)
T KOG3204|consen  149 TLEEKRKEKAKIHYQKK  165 (197)
T ss_pred             HHHHHHhHhhhhhHHHH
Confidence            49999999998855533


No 47 
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=21.71  E-value=92  Score=21.26  Aligned_cols=32  Identities=28%  Similarity=0.378  Sum_probs=19.8

Q ss_pred             CCCCCCCCCCCCChhhhhhhhhhHHHHHHHHHhhcc
Q 032019            1 MDPTQRQTPPSYSKESLIRRYKPIWRILLISNLALG   36 (148)
Q Consensus         1 ~dp~~~~ppp~~pK~~f~rRYK~iwp~LLavNL~vG   36 (148)
                      +|++..|.-|.-||..++-    +..+++..=+|+|
T Consensus        44 vd~A~~P~~P~~P~~~lil----~l~~~~Gl~lgi~   75 (82)
T PF13807_consen   44 VDPAIVPDKPVSPKRALIL----ALGLFLGLILGIG   75 (82)
T ss_pred             ccccccCCCCCCCcHHHHH----HHHHHHHHHHHHH
Confidence            4888888888888766553    3334444444444


No 48 
>PRK14746 RepA leader peptide Tap; Provisional
Probab=21.40  E-value=42  Score=20.25  Aligned_cols=15  Identities=27%  Similarity=0.381  Sum_probs=12.2

Q ss_pred             hHHHHHHHHHhhcce
Q 032019           23 PIWRILLISNLALGG   37 (148)
Q Consensus        23 ~iwp~LLavNL~vGa   37 (148)
                      ++|-+||..|+.-|.
T Consensus         8 l~~~lLLpCniSAg~   22 (26)
T PRK14746          8 LLRLLLLPCNISAGR   22 (26)
T ss_pred             HHHHHHhcceecccc
Confidence            468889999998774


No 49 
>PF11069 DUF2870:  Protein of unknown function (DUF2870);  InterPro: IPR021298  This is a eukaryotic family of proteins with unknown function. 
Probab=21.36  E-value=1e+02  Score=23.49  Aligned_cols=15  Identities=20%  Similarity=0.521  Sum_probs=13.1

Q ss_pred             CCCHHHHHHHHHHHH
Q 032019           98 PIPEDQQRELFKWIL  112 (148)
Q Consensus        98 PIpeDeQrel~KWiL  112 (148)
                      +|+|++|++|+-++-
T Consensus        46 ~isee~qk~mm~~~~   60 (98)
T PF11069_consen   46 VISEEEQKAMMAYYY   60 (98)
T ss_pred             CCCHHHHHHHHHHHH
Confidence            489999999988875


No 50 
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=20.65  E-value=58  Score=27.44  Aligned_cols=16  Identities=31%  Similarity=0.640  Sum_probs=14.4

Q ss_pred             hHHHHHHHHHHhhcCC
Q 032019          130 DEEKAILKQFIRAESI  145 (148)
Q Consensus       130 dEeKalLK~fIRaksi  145 (148)
                      ++|+.||+-|++.+||
T Consensus       140 ~~~~~iL~~~~~~gsl  155 (188)
T COG2411         140 ERDKRILELFVEEGSL  155 (188)
T ss_pred             HHHHHHHHHHHHcCcH
Confidence            5789999999999986


No 51 
>PF11898 DUF3418:  Domain of unknown function (DUF3418);  InterPro: IPR024590 This entry represents the uncharacterised C-terminal domain of HrpA.
Probab=20.33  E-value=65  Score=30.48  Aligned_cols=29  Identities=38%  Similarity=0.717  Sum_probs=20.0

Q ss_pred             HHHHHHHHHHHHhhh------cCCCCChHhhhhch
Q 032019          102 DQQRELFKWILEEKR------KVKPKDPKEKKRID  130 (148)
Q Consensus       102 DeQrel~KWiLEEKR------Kikpkd~~EKkrid  130 (148)
                      +.+.+-|.|||||=|      .+++.-+---|||+
T Consensus       546 ~~~l~~~rWmlEElRVSlFAQeLgT~~pVS~KRL~  580 (586)
T PF11898_consen  546 DPALEEFRWMLEELRVSLFAQELGTAMPVSEKRLE  580 (586)
T ss_pred             CHHHHHHHHHHHHHHHHHHHhhcCCCCCCCHHHHH
Confidence            678899999999987      35555544444443


No 52 
>PF07242 DUF1430:  Protein of unknown function (DUF1430);  InterPro: IPR006541 These sequences represent a family of integral membrane proteins, most of which are about 650 residues in size and predicted to span the membrane seven times. Nearly half of the members of this family are found in association with a member of the lactococcin 972 family of bacteriocins (IPR006540 from INTERPRO) []. Others may be associated with uncharacterised proteins that may also act as bacteriocins. Although this protein is suggested to be an immunity protein, and the bacteriocin is suggested to be exported by a Sec-dependent process, the role of this protein is unclear. 
Probab=20.30  E-value=74  Score=22.78  Aligned_cols=29  Identities=24%  Similarity=0.138  Sum_probs=22.4

Q ss_pred             hhhhhhhhHHHHHHHHHhhcceeeeeeee
Q 032019           16 SLIRRYKPIWRILLISNLALGGYMFAKAR   44 (148)
Q Consensus        16 ~f~rRYK~iwp~LLavNL~vGaYlF~rtk   44 (148)
                      +|.+|||-.+-+.+++|+..++-.+..++
T Consensus        35 sf~~~hk~yl~~~~~~~~~~~~~~~~~~~   63 (100)
T PF07242_consen   35 SFFERHKRYLISQLIVWILGLGISFILSK   63 (100)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            78999999888888888877765554443


No 53 
>PF03580 Herpes_UL14:  Herpesvirus UL14-like protein;  InterPro: IPR005207 This is a family of Herpesvirus proteins including UL14. UL14 protein is a minor component of the virion tegument [] and is expressed late in infection. UL14 protein can influence the intracellular localization patterns of a number of proteins belonging to the capsid or the DNA encapsidation machinery [].
Probab=20.28  E-value=46  Score=26.97  Aligned_cols=17  Identities=29%  Similarity=0.601  Sum_probs=14.7

Q ss_pred             CCHHHHHHHHHHHHHhh
Q 032019           99 IPEDQQRELFKWILEEK  115 (148)
Q Consensus        99 IpeDeQrel~KWiLEEK  115 (148)
                      ..+++--=|.+||||++
T Consensus       133 l~~~deaLL~~W~Le~~  149 (149)
T PF03580_consen  133 LDEEDEALLTQWQLESA  149 (149)
T ss_pred             cCchHHHHHHHHHhccC
Confidence            78888888999999975


Done!