Query         032039
Match_columns 148
No_of_seqs    18 out of 20
Neff          2.0 
Searched_HMMs 46136
Date          Fri Mar 29 08:46:21 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032039.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032039hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09933 DUF2165:  Predicted sm  48.7      10 0.00023   30.1   1.4   17   74-90     29-45  (160)
  2 COG5472 Predicted small integr  37.1     4.4 9.6E-05   33.1  -2.3   18   74-91     29-46  (164)
  3 COG1460 Uncharacterized protei  29.8      42 0.00092   26.0   2.1   24   65-88     26-49  (114)
  4 PF15366 DUF4597:  Domain of un  28.4      55  0.0012   23.3   2.3   32   36-69     29-62  (62)
  5 KOG2178 Predicted sugar kinase  26.9      31 0.00068   31.7   1.1   31   92-131   190-220 (409)
  6 PF14770 TMEM18:  Transmembrane  21.6      30 0.00064   26.5  -0.1   18  103-122    63-80  (123)
  7 PF00525 Crystallin:  Alpha cry  20.3      30 0.00064   24.3  -0.3   15  108-123    19-33  (59)
  8 cd03721 SOCS_ASB2 SOCS (suppre  18.5 1.1E+02  0.0024   19.7   2.0   26   71-99     11-36  (45)
  9 cd01137 PsaA Metal binding pro  16.6      66  0.0014   26.3   0.9   32   65-96    139-175 (287)
 10 cd05135 RasGAP_RASAL Ras GTPas  14.7 1.7E+02  0.0036   25.5   2.9   33   68-100   141-175 (333)

No 1  
>PF09933 DUF2165:  Predicted small integral membrane protein (DUF2165);  InterPro: IPR018681 This family of various hypothetical prokaryotic proteins has no known function.
Probab=48.71  E-value=10  Score=30.14  Aligned_cols=17  Identities=41%  Similarity=0.856  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHhhccccc
Q 032039           74 FQRNYQFLQRVFSIDTV   90 (148)
Q Consensus        74 FqRNfQFLqRvfsidt~   90 (148)
                      |.=|+||+|.|+|.||.
T Consensus        29 y~sN~~fV~hVlsMdt~   45 (160)
T PF09933_consen   29 YGSNFQFVRHVLSMDTT   45 (160)
T ss_pred             cHHHHHHHHHHHHHHHh
Confidence            56799999999999988


No 2  
>COG5472 Predicted small integral membrane protein [Function unknown]
Probab=37.13  E-value=4.4  Score=33.11  Aligned_cols=18  Identities=33%  Similarity=0.816  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHhhcccccc
Q 032039           74 FQRNYQFLQRVFSIDTVV   91 (148)
Q Consensus        74 FqRNfQFLqRvfsidt~v   91 (148)
                      |+-||||++-|+|.||+.
T Consensus        29 yntNfvFV~HVlSMDT~f   46 (164)
T COG5472          29 YNTNFVFVHHVLSMDTIF   46 (164)
T ss_pred             cccceEeeeeeeeccccC
Confidence            678999999999999983


No 3  
>COG1460 Uncharacterized protein conserved in archaea [Function unknown]
Probab=29.75  E-value=42  Score=25.99  Aligned_cols=24  Identities=13%  Similarity=0.412  Sum_probs=20.8

Q ss_pred             CCChhhHHHHHHHHHHHHHhhccc
Q 032039           65 QLDPQLRYSFQRNYQFLQRVFSID   88 (148)
Q Consensus        65 EIDPeLRysFqRNfQFLqRvfsid   88 (148)
                      +.|+||+|.++||..+++++=.+|
T Consensus        26 ~~~~eL~y~~~~al~y~~kFakld   49 (114)
T COG1460          26 EREEELTYEQREALEYAEKFAKLD   49 (114)
T ss_pred             cccccchHHHHHHHHHHHHHhcCC
Confidence            679999999999999999876544


No 4  
>PF15366 DUF4597:  Domain of unknown function (DUF4597)
Probab=28.45  E-value=55  Score=23.32  Aligned_cols=32  Identities=34%  Similarity=0.532  Sum_probs=17.8

Q ss_pred             cCCCCCeeeecCCCCCCCC--CCCCCCCCCCCCChh
Q 032039           36 EPGATPTMHVPRKVKGSRY--DDVDDDNDDLQLDPQ   69 (148)
Q Consensus        36 qpg~t~TM~vP~~~k~~~~--~~~d~~d~~~EIDPe   69 (148)
                      -|--|. |.+||. .++..  +....-.||.|||||
T Consensus        29 PPTPTg-~~lpRD-s~~~vwlDe~gs~~dD~e~dpE   62 (62)
T PF15366_consen   29 PPTPTG-MMLPRD-SRRTVWLDETGSCPDDGELDPE   62 (62)
T ss_pred             CCCCCc-eecccc-cCcceecccccCCCCccccCCC
Confidence            344444 449988 43221  333344556699997


No 5  
>KOG2178 consensus Predicted sugar kinase [Carbohydrate transport and metabolism]
Probab=26.90  E-value=31  Score=31.72  Aligned_cols=31  Identities=29%  Similarity=0.731  Sum_probs=24.7

Q ss_pred             ccCCchhhhhhccccchhhhhhhhccCCcchhhhhhhhhh
Q 032039           92 KPLPPAMAYNVSRNLSFFTRIFTQFFGKFDFGEHYWELGR  131 (148)
Q Consensus        92 kpLPp~ma~nvsRNl~FFtriFTQFfd~~Gi~~~~~siG~  131 (148)
                      ++.||+|++++. -|||.|        +--++|.|+.|-+
T Consensus       190 ~~VPPV~sFslG-slGFLt--------pf~f~~f~~~l~~  220 (409)
T KOG2178|consen  190 RSVPPVLSFSLG-SLGFLT--------PFPFANFQEQLAR  220 (409)
T ss_pred             CCCCCeEEeecC-Cccccc--------cccHHHHHHHHHH
Confidence            568999999999 899988        4467777777644


No 6  
>PF14770 TMEM18:  Transmembrane protein 18
Probab=21.59  E-value=30  Score=26.48  Aligned_cols=18  Identities=22%  Similarity=0.475  Sum_probs=13.0

Q ss_pred             ccccchhhhhhhhccCCcch
Q 032039          103 SRNLSFFTRIFTQFFGKFDF  122 (148)
Q Consensus       103 sRNl~FFtriFTQFfd~~Gi  122 (148)
                      ++|-.-|.+-  ||||+.|+
T Consensus        63 a~nW~~Fs~q--nYFDs~G~   80 (123)
T PF14770_consen   63 ARNWRSFSKQ--NYFDSSGV   80 (123)
T ss_pred             HHHHHHHhhc--cCcCCCCe
Confidence            4565556554  99999995


No 7  
>PF00525 Crystallin:  Alpha crystallin A chain, N terminal;  InterPro: IPR003090 The crystallins are water-soluble structural proteins that occur in high concentration in the cytoplasm of eye lens fibre cells. Four major groups of crystallin have been distinguished on the basis of size, charge and immunological properties: alpha-, beta- and gamma-crystallins occur in all vertebrate classes (though gamma-crystallins are low or absent in avian lenses); and delta-crystallin is found exclusively in reptiles and birds [, ].  Alpha-crystallin occurs as large aggregates, comprising two types of related subunits (A and B) that are highly similar to the small (15-30kDa) heat shock proteins (HSPs), particularly in their C-terminal halves. The relationship between these families is one of classic gene duplication and divergence, from the small HSP family, allowing adaptation to novel functions. Divergence probably occurred prior to evolution of the eye lens, alpha-crystallin being found in small amounts in tissues outside the lens []. Alpha-crystallin has chaperone-like properties including the ability to prevent the precipitation of denatured proteins and to increase cellular tolerance to stress []. It has been suggested that these functions are important for the maintenance of lens transparency and the prevention of cataracts. This is supported by the observation that alpha-crystallin mutations show an association with cataract formation. This entry represents the N-terminal domain of alpha-crystallin. It is not necessary for dimerisation or chaperone activity, but appears to be required for the formation of higher order aggregates [, ].; GO: 0005212 structural constituent of eye lens; PDB: 2YGD_P.
Probab=20.31  E-value=30  Score=24.29  Aligned_cols=15  Identities=47%  Similarity=0.591  Sum_probs=10.5

Q ss_pred             hhhhhhhhccCCcchh
Q 032039          108 FFTRIFTQFFGKFDFG  123 (148)
Q Consensus       108 FFtriFTQFfd~~Gi~  123 (148)
                      +=+|||.|+|. ||+.
T Consensus        19 ~PsRiFDQ~FG-EgL~   33 (59)
T PF00525_consen   19 FPSRIFDQNFG-EGLF   33 (59)
T ss_dssp             -SCHHHCTTSE-ESST
T ss_pred             CchhhHHHhhc-cccC
Confidence            34799999996 4543


No 8  
>cd03721 SOCS_ASB2 SOCS (suppressors of cytokine signaling) box of ASB2-like proteins. ASB family members have a C-terminal SOCS box and an N-terminal ankyrin-related sequence. ASB2 targets specific proteins to destruction by the proteasome in leukemia cells that have been induced to differentiate. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions.
Probab=18.45  E-value=1.1e+02  Score=19.69  Aligned_cols=26  Identities=35%  Similarity=0.600  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHhhccccccccCCchhh
Q 032039           71 RYSFQRNYQFLQRVFSIDTVVKPLPPAMA   99 (148)
Q Consensus        71 RysFqRNfQFLqRvfsidt~vkpLPp~ma   99 (148)
                      |++.++.+.. ++.-.|+.+  |||+.+.
T Consensus        11 Rl~IR~~lg~-~~l~~I~~L--~LP~~Lk   36 (45)
T cd03721          11 RLKVRTLIGI-NRIKLIDTL--PLPPRLI   36 (45)
T ss_pred             HHHHHHHHhH-HhhccCccC--CCCHHHH
Confidence            6777777776 555578777  8998764


No 9  
>cd01137 PsaA Metal binding protein PsaA.  These proteins have been shown to function as initial receptors in ABC transport of Mn2+ and as surface adhesins in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=16.61  E-value=66  Score=26.30  Aligned_cols=32  Identities=19%  Similarity=0.428  Sum_probs=24.8

Q ss_pred             CCChhhHHHHHHHHH-HHHHhhcccc----ccccCCc
Q 032039           65 QLDPQLRYSFQRNYQ-FLQRVFSIDT----VVKPLPP   96 (148)
Q Consensus        65 EIDPeLRysFqRNfQ-FLqRvfsidt----~vkpLPp   96 (148)
                      ++||+-+=.|+.|++ |+++.-.++.    .++++|.
T Consensus       139 ~~dP~~~~~y~~N~~~~~~~L~~l~~~~~~~l~~~~~  175 (287)
T cd01137         139 EADPANAETYQKNAAAYKAKLKALDEWAKAKFATIPA  175 (287)
T ss_pred             HHCcccHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCc
Confidence            889999999999998 5565555555    6777765


No 10 
>cd05135 RasGAP_RASAL Ras GTPase activating-like protein (RASAL) or RASAL1 is a member of the GAP1 family, and a Ca2+ sensor responding in-phase to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras. It contains a conserved domain structure comprising N-terminal tandem C2 domains, a highly conserved central RasGAP domain, and a C-terminal pleckstrin-homology domain that is associated with a Bruton's tyrosine kinase motif. RASAL, like Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), is a cytosolic protein that undergoes a rapid translocation to the plasma membrane in response to receptor-mediated elevation in the concentration of intracellular free Ca2+, a translocation that activates its ability to function as a RasGAP. However, unlike RASAL4, RASAL undergoes an oscillatory translocation to the plasma membrane that occurs in synchrony with repetitive Ca2+ spikes.
Probab=14.72  E-value=1.7e+02  Score=25.50  Aligned_cols=33  Identities=27%  Similarity=0.351  Sum_probs=19.4

Q ss_pred             hhhHHHHHHHHH-HHHHhh-ccccccccCCchhhh
Q 032039           68 PQLRYSFQRNYQ-FLQRVF-SIDTVVKPLPPAMAY  100 (148)
Q Consensus        68 PeLRysFqRNfQ-FLqRvf-sidt~vkpLPp~ma~  100 (148)
                      ||.|=.+-+|.+ +++.++ +|-.-+.-+|+.|+|
T Consensus       141 ~e~~e~~i~~L~~~~~~~~~~I~~S~~~~P~~lR~  175 (333)
T cd05135         141 EEVRESSLEMLQGYLSSITDAIVGSVSQCPPVMRL  175 (333)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhHHhCCHHHHH
Confidence            355544555555 344444 355556678988876


Done!