Citrus Sinensis ID: 032063


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MASKRILKELRDLQRDPPTSCSAGPVAEDMFHWQATIIGPNDSPYAGGVFVVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGNICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMCKTDKTKYESSARSWTQKYAMG
cHHHHHHHHHHHHHcccccccEEEEccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHccc
*ASKRILKELRDLQRDPPTSCSAGPVAEDMFHWQATIIGPNDSPYAGGVFVVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGNICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMCKTDKTKYESSARSWTQKYAM*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASKRILKELRDLQRDPPTSCSAGPVAEDMFHWQATIIGPNDSPYAGGVFVVTIHFPPDYPFKPPKVAFKTKVFHPNINSNGNICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMCKTDKTKYESSARSWTQKYAMG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SUMO-conjugating enzyme UBC9 Accepts the ubiquitin-like protein SUMO/SMT3 from the E1 complex and catalyzes its covalent attachment to other proteins. Mediates the selective degradation of short-lived and abnormal proteins.confidentP35132
Ubiquitin-conjugating enzyme E2 10 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Mediates the selective degradation of short-lived and abnormal proteins.confidentP35133
Ubiquitin-conjugating enzyme E2 5B E2 conjugating enzyme that associates with the E3 ubiquitin-protein ligase EL5 to mediates ubiquitination of target proteins.confidentQ8S919

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DDG, chain A
Confidence level:very confident
Coverage over the Query: 1-148
View the alignment between query and template
View the model in PyMOL