Query         032074
Match_columns 148
No_of_seqs    24 out of 26
Neff          2.7 
Searched_HMMs 46136
Date          Fri Mar 29 09:16:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032074.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032074hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14162 YozD:  YozD-like prote  41.6      19 0.00041   25.2   1.7   16   66-81     15-30  (57)
  2 COG2886 Uncharacterized small   37.9      21 0.00046   26.4   1.6   18   64-81     54-71  (88)
  3 PF13384 HTH_23:  Homeodomain-l  22.8      28 0.00061   21.1   0.0   10  130-139    41-50  (50)
  4 PF03013 Pyr_excise:  Pyrimidin  22.2      55  0.0012   25.4   1.5   17   68-84     68-84  (130)
  5 PF11121 DUF2639:  Protein of u  16.5      91   0.002   20.5   1.3   12   67-78      7-18  (40)
  6 PF04368 DUF507:  Protein of un  14.5   1E+02  0.0022   25.3   1.4   12   66-77    171-182 (183)
  7 PF00488 MutS_V:  MutS domain V  14.3 1.9E+02  0.0041   23.5   3.0   27   46-76     88-114 (235)
  8 PLN00112 malate dehydrogenase   14.1   2E+02  0.0044   26.4   3.4   12   43-54     49-60  (444)
  9 TIGR02328 conserved hypothetic  13.5 1.3E+02  0.0029   23.7   1.8   30   67-98     56-85  (120)
 10 PF08970 Sda:  Sporulation inhi  12.9 1.5E+02  0.0033   19.7   1.7   14   66-79     27-40  (46)

No 1  
>PF14162 YozD:  YozD-like protein
Probab=41.61  E-value=19  Score=25.21  Aligned_cols=16  Identities=44%  Similarity=0.825  Sum_probs=13.6

Q ss_pred             hhhHHHHHHcCCCCCC
Q 032074           66 SLFMKELKRRGMTPTS   81 (148)
Q Consensus        66 SLFmKELkRRGmaptS   81 (148)
                      ..|-+||-|||.-|+-
T Consensus        15 efFy~eL~kRGyvP~e   30 (57)
T PF14162_consen   15 EFFYHELVKRGYVPTE   30 (57)
T ss_pred             HHHHHHHHHccCCCcH
Confidence            4699999999998864


No 2  
>COG2886 Uncharacterized small protein [Function unknown]
Probab=37.92  E-value=21  Score=26.43  Aligned_cols=18  Identities=28%  Similarity=0.466  Sum_probs=14.2

Q ss_pred             chhhhHHHHHHcCCCCCC
Q 032074           64 PESLFMKELKRRGMTPTS   81 (148)
Q Consensus        64 pESLFmKELkRRGmaptS   81 (148)
                      +=-.|+.||++||..+-+
T Consensus        54 sl~ef~~eL~~R~i~l~~   71 (88)
T COG2886          54 SLNEFEEELRKRGIPLYD   71 (88)
T ss_pred             CHHHHHHHHHHhCCCccc
Confidence            345799999999996654


No 3  
>PF13384 HTH_23:  Homeodomain-like domain; PDB: 2X48_C.
Probab=22.85  E-value=28  Score=21.07  Aligned_cols=10  Identities=40%  Similarity=0.391  Sum_probs=0.0

Q ss_pred             ccccchhhHH
Q 032074          130 LNSEGLEVAS  139 (148)
Q Consensus       130 LNSEGLEGLi  139 (148)
                      -|.+|+|||.
T Consensus        41 ~~~~G~~gL~   50 (50)
T PF13384_consen   41 YREEGLEGLL   50 (50)
T ss_dssp             ----------
T ss_pred             cccccccccC
Confidence            3678888874


No 4  
>PF03013 Pyr_excise:  Pyrimidine dimer DNA glycosylase;  InterPro: IPR004260 Pyrimidine dimer DNA glycosylases are enzymes responsible for initiating the base excision repair pathway, excising pyrimidine dimers by hydrolysis of the glycosylic bond of the 5' pyrimidine, followed by the intra-pyrimidine phosphodiester bond []. One such enzyme is T4 endonuclease V, an enzyme responsible for the first step of a pyrimidine-dimer-specific excision-repair pathway []. Bacteriophage T4 that are deficient in these enzymes are extremely sensitive to UV.; PDB: 2FCC_B 1ENJ_A 1ENI_A 1ENK_A 1VAS_A 2END_A.
Probab=22.21  E-value=55  Score=25.43  Aligned_cols=17  Identities=41%  Similarity=0.649  Sum_probs=9.6

Q ss_pred             hHHHHHHcCCCCCCccc
Q 032074           68 FMKELKRRGMTPTSLLE   84 (148)
Q Consensus        68 FmKELkRRGmaptSl~~   84 (148)
                      -|+|+++||..|.+...
T Consensus        68 l~~EM~~RGY~~~~~~~   84 (130)
T PF03013_consen   68 LMAEMQRRGYKPNSPWF   84 (130)
T ss_dssp             HHHHHHHTT---S--S-
T ss_pred             HHHHHHHcCCCCChhhh
Confidence            48999999999987763


No 5  
>PF11121 DUF2639:  Protein of unknown function (DUF2639);  InterPro: IPR022580  This family is conserved in the Bacillaceae family. Several members are named as being YflJ, but the function is not known. 
Probab=16.50  E-value=91  Score=20.52  Aligned_cols=12  Identities=42%  Similarity=0.816  Sum_probs=10.6

Q ss_pred             hhHHHHHHcCCC
Q 032074           67 LFMKELKRRGMT   78 (148)
Q Consensus        67 LFmKELkRRGma   78 (148)
                      -|.+|||..|++
T Consensus         7 w~V~eLKk~GI~   18 (40)
T PF11121_consen    7 WYVKELKKLGIR   18 (40)
T ss_pred             HHHHHHHHhCcc
Confidence            589999999995


No 6  
>PF04368 DUF507:  Protein of unknown function (DUF507);  InterPro: IPR007463 This entry represents a bacterial protein of unknown function.
Probab=14.52  E-value=1e+02  Score=25.30  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=10.0

Q ss_pred             hhhHHHHHHcCC
Q 032074           66 SLFMKELKRRGM   77 (148)
Q Consensus        66 SLFmKELkRRGm   77 (148)
                      -++..||++|||
T Consensus       171 k~yeeel~krGl  182 (183)
T PF04368_consen  171 KLYEEELRKRGL  182 (183)
T ss_pred             HHHHHHHHHcCC
Confidence            456789999998


No 7  
>PF00488 MutS_V:  MutS domain V C-terminus.;  InterPro: IPR000432 Mismatch repair contributes to the overall fidelity of DNA replication and is essential for combating the adverse effects of damage to the genome. It involves the correction of mismatched base pairs that have been missed by the proofreading element of the DNA polymerase complex. The post-replicative Mismatch Repair System (MMRS) of Escherichia coli involves MutS (Mutator S), MutL and MutH proteins, and acts to correct point mutations or small insertion/deletion loops produced during DNA replication []. MutS and MutL are involved in preventing recombination between partially homologous DNA sequences. The assembly of MMRS is initiated by MutS, which recognises and binds to mispaired nucleotides and allows further action of MutL and MutH to eliminate a portion of newly synthesized DNA strand containing the mispaired base []. MutS can also collaborate with methyltransferases in the repair of O(6)-methylguanine damage, which would otherwise pair with thymine during replication to create an O(6)mG:T mismatch []. MutS exists as a dimer, where the two monomers have different conformations and form a heterodimer at the structural level []. Only one monomer recognises the mismatch specifically and has ADP bound. Non-specific major groove DNA-binding domains from both monomers embrace the DNA in a clamp-like structure. Mismatch binding induces ATP uptake and a conformational change in the MutS protein, resulting in a clamp that translocates on DNA.  MutS is a modular protein with a complex structure [], and is composed of:   N-terminal mismatch-recognition domain, which is similar in structure to tRNA endonuclease. Connector domain, which is similar in structure to Holliday junction resolvase ruvC. Core domain, which is composed of two separate subdomains that join together to form a helical bundle; from within the core domain, two helices act as levers that extend towards (but do not touch) the DNA. Clamp domain, which is inserted between the two subdomains of the core domain at the top of the lever helices; the clamp domain has a beta-sheet structure. ATPase domain (connected to the core domain), which has a classical Walker A motif. HTH (helix-turn-helix) domain, which is involved in dimer contacts.   The MutS family of proteins is named after the Salmonella typhimurium MutS protein involved in mismatch repair. Homologues of MutS have been found in many species including eukaryotes (MSH 1, 2, 3, 4, 5, and 6 proteins), archaea and bacteria, and together these proteins have been grouped into the MutS family. Although many of these proteins have similar activities to the E. coli MutS, there is significant diversity of function among the MutS family members. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein [].This diversity is even seen within species, where many species encode multiple MutS homologues with distinct functions []. Inter-species homologues may have arisen through frequent ancient horizontal gene transfer of MutS (and MutL) from bacteria to archaea and eukaryotes via endosymbiotic ancestors of mitochondria and chloroplasts [].  This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [], bacterial proteins involved in DNA mismatch repair, and the predicted protein product of the Rep-3 gene of mouse share extensive sequence similarity. Human MSH has been implicated in non-polyposis colorectal carcinoma (HNPCC) and is a mismatch binding protein. ; GO: 0005524 ATP binding, 0030983 mismatched DNA binding, 0006298 mismatch repair; PDB: 1FW6_A 1EWQ_A 1EWR_B 1NNE_B 2WTU_A 1OH7_A 1OH5_B 1W7A_B 1NG9_A 1OH8_B ....
Probab=14.32  E-value=1.9e+02  Score=23.53  Aligned_cols=27  Identities=26%  Similarity=0.400  Sum_probs=16.1

Q ss_pred             EEEeeeccCCCCCCCCCCchhhhHHHHHHcC
Q 032074           46 KVCCGVQEGDKQSNGEEPPESLFMKELKRRG   76 (148)
Q Consensus        46 rV~c~~~eg~~~~~geE~pESLFmKELkRRG   76 (148)
                      ++.++....|+..+    -.|.|+.||++=.
T Consensus        88 ~I~t~~~~~d~~~~----~~S~F~~E~~~~~  114 (235)
T PF00488_consen   88 RIFTRIGDDDSIES----GLSTFMAEMKRLS  114 (235)
T ss_dssp             EEEEEES---SSTT----SSSHHHHHHHHHH
T ss_pred             EEEeeccccccccc----ccccHHHhHHHHH
Confidence            45555554444333    3899999999855


No 8  
>PLN00112 malate dehydrogenase (NADP); Provisional
Probab=14.05  E-value=2e+02  Score=26.39  Aligned_cols=12  Identities=17%  Similarity=0.623  Sum_probs=9.2

Q ss_pred             ceeEEEeeeccC
Q 032074           43 RKFKVCCGVQEG   54 (148)
Q Consensus        43 ~~lrV~c~~~eg   54 (148)
                      ..+||+|++...
T Consensus        49 ~~~~~~~~~~~~   60 (444)
T PLN00112         49 TNARISCSVNQA   60 (444)
T ss_pred             cccceeeccccc
Confidence            577999998644


No 9  
>TIGR02328 conserved hypothetical protein. Members of this protein are found in a small number of taxonomically well separated species, yet are strongly conserved, suggesting lateral gene transfer. Members are found in Treponema denticola, Clostridium acetobutylicum, and several of the Firmicutes. The function of this protein is unknown.
Probab=13.52  E-value=1.3e+02  Score=23.74  Aligned_cols=30  Identities=20%  Similarity=0.222  Sum_probs=18.8

Q ss_pred             hhHHHHHHcCCCCCCccccCCCCCCCcchhhh
Q 032074           67 LFMKELKRRGMTPTSLLEDSSRTDSGLDDKTK   98 (148)
Q Consensus        67 LFmKELkRRGmaptSl~~~~~~s~~G~~~e~~   98 (148)
                      +-|+|+++||-.|.-.--  ++...|-.-+..
T Consensus        56 lv~~EM~~RGY~~~~~W~--d~~yRG~~~~~y   85 (120)
T TIGR02328        56 LVMEEMATRGYHVSKQWL--DPNYRGQNCPNY   85 (120)
T ss_pred             HHHHHHHHcCCCCChhhc--CccccCCcCCcc
Confidence            448999999998876432  233445544443


No 10 
>PF08970 Sda:  Sporulation inhibitor A;  InterPro: IPR015064 Members of this protein group contain two antiparallel alpha helices that are linked by a highly structured inter-helix loop to form a helical hairpin; the structure is stabilised by numerous hydrophobic and electrostatic interactions. These sporulation inhibitors are antikinases that bind to the histidine kinase KinA phosphotransfer domain and act as a molecular barricade that inhibit productive interaction between the ATP binding site and the phosphorylatable KinA His residue. This results in the inhibition of sporulation (by preventing phosphorylation of spo0A) []. ; PDB: 3FYR_B 1PV0_A.
Probab=12.93  E-value=1.5e+02  Score=19.70  Aligned_cols=14  Identities=29%  Similarity=0.584  Sum_probs=10.6

Q ss_pred             hhhHHHHHHcCCCC
Q 032074           66 SLFMKELKRRGMTP   79 (148)
Q Consensus        66 SLFmKELkRRGmap   79 (148)
                      .|..+|+.|||+..
T Consensus        27 ~Ll~~Ei~rR~L~~   40 (46)
T PF08970_consen   27 RLLEEEIQRRSLKH   40 (46)
T ss_dssp             HHHHHHHHHCT-TT
T ss_pred             HHHHHHHHHcCCcc
Confidence            46789999999854


Done!