Query         032077
Match_columns 147
No_of_seqs    131 out of 661
Neff          4.6 
Searched_HMMs 46136
Date          Fri Mar 29 09:18:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032077.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032077hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02519 Auxin_inducible:  Auxi 100.0 1.2E-37 2.6E-42  228.4  10.3   99    1-107     1-100 (100)
  2 PLN03090 auxin-responsive fami 100.0 3.3E-35 7.1E-40  217.6  10.4   91    4-106    12-103 (104)
  3 PLN03219 uncharacterized prote 100.0 9.3E-32   2E-36  200.1   9.7   69   37-105    32-104 (108)
  4 PLN03220 uncharacterized prote 100.0   1E-31 2.2E-36  199.0   9.8   67   38-104    29-101 (105)
  5 PRK02899 adaptor protein; Prov  85.0    0.75 1.6E-05   37.3   2.5   25   68-92     38-62  (197)
  6 PF02214 BTB_2:  BTB/POZ domain  82.2    0.68 1.5E-05   32.1   1.1   54   56-109     7-63  (94)
  7 PRK02315 adaptor protein; Prov  79.8     1.4 2.9E-05   36.6   2.2   25   68-92     38-62  (233)
  8 PF05389 MecA:  Negative regula  75.0    0.94   2E-05   36.6   0.0   25   68-92     38-62  (220)
  9 smart00666 PB1 PB1 domain. Pho  72.8     7.1 0.00015   26.1   3.9   51   52-107     8-69  (81)
 10 cd05992 PB1 The PB1 domain is   71.6       9 0.00019   25.4   4.2   52   52-107     7-69  (81)
 11 PF00651 BTB:  BTB/POZ domain;   55.6      31 0.00066   23.4   4.6   56   50-109    14-74  (111)
 12 cd06407 PB1_NLP A PB1 domain i  54.0      24 0.00052   24.8   3.9   49   50-102     5-65  (82)
 13 PF07429 Glyco_transf_56:  4-al  52.6      67  0.0015   28.9   7.2   62   43-107   180-264 (360)
 14 PF14317 YcxB:  YcxB-like prote  49.3      32 0.00069   21.0   3.5   32   45-76     28-59  (62)
 15 COG1759 5-formaminoimidazole-4  40.6      14  0.0003   33.1   1.1   78   41-120    87-199 (361)
 16 PF08948 DUF1859:  Domain of un  40.4      13 0.00028   28.4   0.8   28   45-72     86-123 (126)
 17 cd06396 PB1_NBR1 The PB1 domai  37.7   1E+02  0.0022   22.0   5.0   56   50-108     5-69  (81)
 18 cd06397 PB1_UP1 Uncharacterize  35.5      88  0.0019   22.6   4.3   46   52-101     7-63  (82)
 19 cd06401 PB1_TFG The PB1 domain  34.6      74  0.0016   22.9   3.8   43   50-95      5-61  (81)
 20 PF00564 PB1:  PB1 domain;  Int  33.7      65  0.0014   21.3   3.4   43   52-98      8-62  (84)
 21 PF02209 VHP:  Villin headpiece  33.0      18  0.0004   22.1   0.5   19   65-83      1-19  (36)
 22 PF06849 DUF1246:  Protein of u  32.6     2.2 4.8E-05   32.9  -4.5   23   41-63     67-92  (124)
 23 smart00153 VHP Villin headpiec  32.1      24 0.00051   21.5   0.9   19   65-83      1-19  (36)
 24 PF12058 DUF3539:  Protein of u  32.0     7.4 0.00016   28.4  -1.6   14   64-77      4-17  (88)
 25 cd06398 PB1_Joka2 The PB1 doma  31.6      89  0.0019   22.4   3.9   52   52-103     7-71  (91)
 26 COG4923 Predicted nuclease (RN  30.8      70  0.0015   27.1   3.7   14   89-102    88-101 (245)
 27 PF00191 Annexin:  Annexin;  In  30.5      77  0.0017   20.1   3.2   37   68-120    29-65  (66)
 28 PF11834 DUF3354:  Domain of un  30.4      40 0.00086   23.3   1.9   17   69-85     26-42  (69)
 29 COG4862 MecA Negative regulato  29.3      37 0.00081   28.7   1.8   27   67-93     37-63  (224)
 30 PF11822 DUF3342:  Domain of un  27.2      69  0.0015   28.3   3.2   52   56-110    13-69  (317)
 31 PRK13277 5-formaminoimidazole-  27.1      27 0.00058   31.3   0.7   26   41-68     87-115 (366)
 32 PF04332 DUF475:  Protein of un  25.2      45 0.00097   29.2   1.7   16    2-17      6-21  (294)
 33 KOG1290 Serine/threonine prote  24.1      44 0.00096   31.7   1.5   19   44-62     62-83  (590)
 34 PRK02797 4-alpha-L-fucosyltran  23.0 1.7E+02  0.0037   25.9   4.9   62   43-107   141-225 (322)
 35 cd04751 Commd3 COMM_Domain con  22.1      96  0.0021   22.1   2.7   29   87-116    64-92  (95)
 36 cd04395 RhoGAP_ARHGAP21 RhoGAP  21.9   2E+02  0.0044   22.5   4.8   42   69-110    19-60  (196)
 37 COG2899 Uncharacterized protei  21.2      47   0.001   29.5   1.1   16    2-17     56-71  (346)
 38 cd01406 SIR2-like Sir2-like: P  20.8 1.7E+02  0.0036   23.4   4.1   34   47-87      1-36  (242)
 39 PF05194 UreE_C:  UreE urease a  20.7 1.4E+02   0.003   20.7   3.2   28   46-78     24-51  (87)
 40 cd06404 PB1_aPKC PB1 domain is  20.3   2E+02  0.0042   20.8   3.9   38   51-92      6-43  (83)
 41 cd06080 MUM1_like Mutated mela  20.1 1.5E+02  0.0033   20.9   3.3   39   45-83     28-74  (80)

No 1  
>PF02519 Auxin_inducible:  Auxin responsive protein;  InterPro: IPR003676 This family consists of the protein products of a gene cluster that encodes a group of auxin-regulated RNAs (small auxin up RNAs, SAURs) []. Proteins from this ARG7 auxin responsive genes family have no identified functional role [].
Probab=100.00  E-value=1.2e-37  Score=228.37  Aligned_cols=99  Identities=40%  Similarity=0.730  Sum_probs=87.3

Q ss_pred             CCChHHHHHHHHHHhhhhhcccCcccCCCCCCCCCCCCcCCCccCCCeEEEEecC-ceeeeEeccCcCcHHHHHHHHHhH
Q 032077            1 MISPKKLIKMSKKWQKLAASKQKRISFPTTGPVDAESCRTSSVCEKGHFVVYATD-EKRFVIPLAYLKNNVIRELFKMAE   79 (147)
Q Consensus         1 m~~~~kL~~~akKWqk~aa~~rkr~s~~~~~~~~~~~~~~~~~vpkG~~~VYVGe-~~RfvVp~~yLnhP~F~~LL~~ae   79 (147)
                      ||+.+|..+.++||++.++..+++.+..+..        ...++|+||||||||+ ++||+||++|||||+|++||++||
T Consensus         1 M~~~~k~~~~~~k~~~~~~~~~~~~~~~~~~--------~~~~vp~G~~~VyVG~~~~Rfvvp~~~L~hp~f~~LL~~ae   72 (100)
T PF02519_consen    1 MASRLKSLASAKKWQSRARSKSSSSSSSRSS--------SESDVPKGHFAVYVGEERRRFVVPVSYLNHPLFQELLEQAE   72 (100)
T ss_pred             CccHHHHHHHHHhhhhhhhhccccccccccc--------ccCCCCCCeEEEEeCccceEEEechHHcCchhHHHHHHHHh
Confidence            9999999999999998876665544332221        1368999999999997 899999999999999999999999


Q ss_pred             HhcCCCCCCCeeecCcHHHHHHHHHHHh
Q 032077           80 DEFGLPSCGPITLPCDAVFMEYVVSLIQ  107 (147)
Q Consensus        80 eEfG~~~~G~L~IPC~~~~Fe~vl~li~  107 (147)
                      |||||+++|+|+|||++++|++++|+|+
T Consensus        73 eEfG~~~~G~l~iPC~~~~Fe~~l~~le  100 (100)
T PF02519_consen   73 EEFGFDQDGPLTIPCDVVLFEHLLWLLE  100 (100)
T ss_pred             hhcCcCCCCcEEeeCCHHHHHHHHHHhC
Confidence            9999999999999999999999999985


No 2  
>PLN03090 auxin-responsive family protein; Provisional
Probab=100.00  E-value=3.3e-35  Score=217.57  Aligned_cols=91  Identities=29%  Similarity=0.541  Sum_probs=78.2

Q ss_pred             hHHHHHHHHHHhhhhhcccCcccCCCCCCCCCCCCcCCCccCCCeEEEEecC-ceeeeEeccCcCcHHHHHHHHHhHHhc
Q 032077            4 PKKLIKMSKKWQKLAASKQKRISFPTTGPVDAESCRTSSVCEKGHFVVYATD-EKRFVIPLAYLKNNVIRELFKMAEDEF   82 (147)
Q Consensus         4 ~~kL~~~akKWqk~aa~~rkr~s~~~~~~~~~~~~~~~~~vpkG~~~VYVGe-~~RfvVp~~yLnhP~F~~LL~~aeeEf   82 (147)
                      ..+|+++.|+|++++..+.        .  + . -..+.+||+||||||||+ ++||+||++|||||+|++||++|||||
T Consensus        12 ~~~~kq~l~r~~s~~~~~~--------~--~-~-~~~~~~vpkG~~aVyVG~~~~RfvVp~~~L~hP~F~~LL~~aeeEf   79 (104)
T PLN03090         12 TAMLKQILKRCSSLGKKQG--------Y--D-E-DGLPLDVPKGHFPVYVGENRSRYIVPISFLTHPEFQSLLQQAEEEF   79 (104)
T ss_pred             HHHHHHHHHHHHHhcccCC--------c--c-c-ccCCCCCCCCcEEEEECCCCEEEEEEHHHcCCHHHHHHHHHHHHHh
Confidence            4678999999987753210        0  0 0 124678999999999997 589999999999999999999999999


Q ss_pred             CCCCCCCeeecCcHHHHHHHHHHH
Q 032077           83 GLPSCGPITLPCDAVFMEYVVSLI  106 (147)
Q Consensus        83 G~~~~G~L~IPC~~~~Fe~vl~li  106 (147)
                      ||+++|+|+|||++++|++++|+|
T Consensus        80 Gf~~~G~L~IPC~~~~Fe~ll~~i  103 (104)
T PLN03090         80 GFDHDMGLTIPCEEVVFRSLTSMI  103 (104)
T ss_pred             CCCCCCcEEEeCCHHHHHHHHHHh
Confidence            999999999999999999999998


No 3  
>PLN03219 uncharacterized protein; Provisional
Probab=99.97  E-value=9.3e-32  Score=200.06  Aligned_cols=69  Identities=36%  Similarity=0.696  Sum_probs=63.7

Q ss_pred             CCcCCCccCCCeEEEEecC---ceeeeEeccCcCcHHHHHHHHHhHHhcCCCC-CCCeeecCcHHHHHHHHHH
Q 032077           37 SCRTSSVCEKGHFVVYATD---EKRFVIPLAYLKNNVIRELFKMAEDEFGLPS-CGPITLPCDAVFMEYVVSL  105 (147)
Q Consensus        37 ~~~~~~~vpkG~~~VYVGe---~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~~-~G~L~IPC~~~~Fe~vl~l  105 (147)
                      ++..+.+|||||||||||+   ++||+||++|||||+|++||++|||||||++ +|+|+|||+++.|++++..
T Consensus        32 ~~~~~~~vpkGh~aVYVG~~~E~kRFvVPi~yL~hP~F~~LL~~AeEEfGf~~~~G~L~IPCd~~~F~~ll~~  104 (108)
T PLN03219         32 STTTSGLVPKGHVAVYVGEQMEKKRFVVPISYLNHPLFREFLNRAEEECGFHHSMGGLTIPCREESFLHLITS  104 (108)
T ss_pred             CCCCCCCCCCCeEEEEECCCCCceEEEEEHHHcCChHHHHHHHHHHHHhCCCCCCCCEEEeCCHHHHHHHHHh
Confidence            3455789999999999996   7999999999999999999999999999997 6999999999999999864


No 4  
>PLN03220 uncharacterized protein; Provisional
Probab=99.97  E-value=1e-31  Score=199.00  Aligned_cols=67  Identities=33%  Similarity=0.704  Sum_probs=62.3

Q ss_pred             CcCCCccCCCeEEEEecC-----ceeeeEeccCcCcHHHHHHHHHhHHhcCCCC-CCCeeecCcHHHHHHHHH
Q 032077           38 CRTSSVCEKGHFVVYATD-----EKRFVIPLAYLKNNVIRELFKMAEDEFGLPS-CGPITLPCDAVFMEYVVS  104 (147)
Q Consensus        38 ~~~~~~vpkG~~~VYVGe-----~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~~-~G~L~IPC~~~~Fe~vl~  104 (147)
                      ++.+.+|||||||||||+     ++|||||++|||||+|++||++|||||||++ +|+|+|||+++.|++++.
T Consensus        29 ~~~~~~VPkGh~aVyVGe~~~~e~kRFVVPv~yL~hP~F~~LL~~AeEEfGf~~~~G~L~IPCd~~~F~~ll~  101 (105)
T PLN03220         29 SSSSDHVPKGHVAVYVGEQIEMEKKRFVVPISFLNHPSFKEFLSRAEEEFGFNHPMGGLTIPCREEVFLDLIA  101 (105)
T ss_pred             ccccCCCCCCeEEEEECCCCCccceEEEEEHHHcCChHHHHHHHHHHHHhCCCCCCCCEEeeCCHHHHHHHHH
Confidence            345679999999999996     6999999999999999999999999999998 699999999999999874


No 5  
>PRK02899 adaptor protein; Provisional
Probab=84.97  E-value=0.75  Score=37.32  Aligned_cols=25  Identities=28%  Similarity=0.693  Sum_probs=21.7

Q ss_pred             cHHHHHHHHHhHHhcCCCCCCCeee
Q 032077           68 NNVIRELFKMAEDEFGLPSCGPITL   92 (147)
Q Consensus        68 hP~F~~LL~~aeeEfG~~~~G~L~I   92 (147)
                      +-+|.++|++|..|+||..+|||+|
T Consensus        38 e~lF~~mm~Ea~~e~~F~~~~pl~~   62 (197)
T PRK02899         38 HQLFRDMMQEANKELGFEADGPIAV   62 (197)
T ss_pred             HHHHHHHHHHhhhccCcccCCeEEE
Confidence            4578888999999999999999864


No 6  
>PF02214 BTB_2:  BTB/POZ domain;  InterPro: IPR003131 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. The Kv family can be divided into several subfamilies on the basis of sequence similarity and function. Four of these subfamilies, Kv1 (Shaker), Kv2 (Shab), Kv3 (Shaw) and Kv4 (Shal), consist of pore-forming alpha subunits that associate with different types of beta subunit. Each alpha subunit comprises six hydrophobic TM domains with a P-domain between the fifth and sixth, which partially resides in the membrane. The fourth TM domain has positively charged residues at every third residue and acts as a voltage sensor, which triggers the conformational change that opens the channel pore in response to a displacement in membrane potential []. More recently, 4 new electrically-silent alpha subunits have been cloned: Kv5 (KCNF), Kv6 (KCNG), Kv8 and Kv9 (KCNS). These subunits do not themselves possess any functional activity, but appear to form heteromeric channels with Kv2 subunits, and thus modulate Shab channel activity []. When highly expressed, they inhibit channel activity, but at lower levels show more specific modulatory actions. The N-terminal, cytoplasmic tetramerization domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily-specific assembly of alpha-subunits into functional tetrameric channels []. This domain is found in a subset of a larger group of proteins that contain the BTB/POZ domain.; GO: 0005249 voltage-gated potassium channel activity, 0006813 potassium ion transport, 0008076 voltage-gated potassium channel complex, 0016020 membrane; PDB: 1NN7_A 3KVT_A 1EXB_E 1QDV_A 1DSX_E 1QDW_F 3LUT_B 3LNM_B 2A79_B 3DRY_C ....
Probab=82.20  E-value=0.68  Score=32.05  Aligned_cols=54  Identities=17%  Similarity=0.247  Sum_probs=40.4

Q ss_pred             ceeeeEeccCcC-c--HHHHHHHHHhHHhcCCCCCCCeeecCcHHHHHHHHHHHhcC
Q 032077           56 EKRFVIPLAYLK-N--NVIRELFKMAEDEFGLPSCGPITLPCDAVFMEYVVSLIQRG  109 (147)
Q Consensus        56 ~~RfvVp~~yLn-h--P~F~~LL~~aeeEfG~~~~G~L~IPC~~~~Fe~vl~li~~~  109 (147)
                      +++|.++.+.|. +  ..|..++........-+.+|.+-|-++...|++|+..++.+
T Consensus         7 G~~f~~~~~tL~~~~~s~l~~~~~~~~~~~~~~~~~~~fiDRdp~~F~~IL~ylr~~   63 (94)
T PF02214_consen    7 GTIFETSRSTLTRYPDSLLARLFSGERSDDYDDDDGEYFIDRDPELFEYILNYLRTG   63 (94)
T ss_dssp             TEEEEEEHHHHHTSTTSTTTSHHHTGHGGGEETTTTEEEESS-HHHHHHHHHHHHHT
T ss_pred             CEEEEEcHHHHhhCCCChhhhHHhhccccccCCccceEEeccChhhhhHHHHHHhhc
Confidence            578888887776 4  47888888653232334679999999999999999999983


No 7  
>PRK02315 adaptor protein; Provisional
Probab=79.82  E-value=1.4  Score=36.58  Aligned_cols=25  Identities=12%  Similarity=0.324  Sum_probs=22.5

Q ss_pred             cHHHHHHHHHhHHhcCCCCCCCeee
Q 032077           68 NNVIRELFKMAEDEFGLPSCGPITL   92 (147)
Q Consensus        68 hP~F~~LL~~aeeEfG~~~~G~L~I   92 (147)
                      +-+|.++|+++..|+||..+|||+|
T Consensus        38 e~fF~~mm~Ea~~e~~F~~~~pl~~   62 (233)
T PRK02315         38 EEFFYSMMDEVDEEDDFADEGPLWF   62 (233)
T ss_pred             HHHHHHHHHHhccccCcccCCeEEE
Confidence            4689999999999999999999864


No 8  
>PF05389 MecA:  Negative regulator of genetic competence (MecA);  InterPro: IPR008681 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. This family contains several bacterial MecA proteins. In complex media competence development is poor, and there is little or no expression of late competence genes. Overexpression of MecA inhibits comG transcription [, , ]. MecA enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC. ; PDB: 3JTP_C 2Y1R_O 3PXI_c 3PXG_b 3JTO_D 3JTN_A.
Probab=75.01  E-value=0.94  Score=36.62  Aligned_cols=25  Identities=24%  Similarity=0.586  Sum_probs=0.0

Q ss_pred             cHHHHHHHHHhHHhcCCCCCCCeee
Q 032077           68 NNVIRELFKMAEDEFGLPSCGPITL   92 (147)
Q Consensus        68 hP~F~~LL~~aeeEfG~~~~G~L~I   92 (147)
                      +-.|.++|+++.+|+||..+|||++
T Consensus        38 e~fF~~ileea~~e~~F~~~~~l~~   62 (220)
T PF05389_consen   38 EEFFYSILEEADEEHGFENDGPLTF   62 (220)
T ss_dssp             -------------------------
T ss_pred             HHHHHHHHHHhccccCcccCCeEEE
Confidence            5689999999999999999999875


No 9  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=72.76  E-value=7.1  Score=26.09  Aligned_cols=51  Identities=22%  Similarity=0.402  Sum_probs=35.2

Q ss_pred             EecCceeeeEeccCcCcHHHHHHHHHhHHhcCCC----------CCC-CeeecCcHHHHHHHHHHHh
Q 032077           52 YATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLP----------SCG-PITLPCDAVFMEYVVSLIQ  107 (147)
Q Consensus        52 YVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~----------~~G-~L~IPC~~~~Fe~vl~li~  107 (147)
                      |.|+.+||.+|-    ...|.+|..+..+.|+..          .+| .++|.++. .++..+.+..
T Consensus         8 ~~~~~~~~~~~~----~~s~~dL~~~i~~~~~~~~~~~~l~Y~Dedgd~v~l~sd~-Dl~~a~~~~~   69 (81)
T smart00666        8 YGGETRRLSVPR----DISFEDLRSKVAKRFGLDNQSFTLKYQDEDGDLVSLTSDE-DLEEAIEEYD   69 (81)
T ss_pred             ECCEEEEEEECC----CCCHHHHHHHHHHHhCCCCCCeEEEEECCCCCEEEecCHH-HHHHHHHHHH
Confidence            445779999985    778999999999999874          234 45677755 3444444443


No 10 
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=71.63  E-value=9  Score=25.39  Aligned_cols=52  Identities=23%  Similarity=0.403  Sum_probs=37.0

Q ss_pred             EecCceeeeEeccCcCcHHHHHHHHHhHHhcCCC----------CCCC-eeecCcHHHHHHHHHHHh
Q 032077           52 YATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLP----------SCGP-ITLPCDAVFMEYVVSLIQ  107 (147)
Q Consensus        52 YVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~----------~~G~-L~IPC~~~~Fe~vl~li~  107 (147)
                      |-|+.+||.+|.   .++.|.+|..+..+.|++.          .+|- ++|.++ ..|+..+....
T Consensus         7 ~~~~~~~~~~~~---~~~s~~~L~~~i~~~~~~~~~~~~l~y~D~e~d~v~l~sd-~Dl~~a~~~~~   69 (81)
T cd05992           7 YGGEIRRFVVVS---RSISFEDLRSKIAEKFGLDAVSFKLKYPDEDGDLVTISSD-EDLEEAIEEAR   69 (81)
T ss_pred             ecCCCEEEEEec---CCCCHHHHHHHHHHHhCCCCCcEEEEeeCCCCCEEEeCCH-HHHHHHHHHHh
Confidence            446889999997   7889999999999998874          2343 455554 45555555554


No 11 
>PF00651 BTB:  BTB/POZ domain;  InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation []. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule []. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [, , ]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.; GO: 0005515 protein binding; PDB: 3M5B_A 1R28_B 3LBZ_A 3E4U_F 3BIM_B 1R2B_A 1R29_A 2VPK_A 2YY9_B 3GA1_A ....
Probab=55.61  E-value=31  Score=23.40  Aligned_cols=56  Identities=21%  Similarity=0.352  Sum_probs=40.2

Q ss_pred             EEEecCceeeeEeccCc--CcHHHHHHHHHhHHhcCCCCCC--Ceeec-CcHHHHHHHHHHHhcC
Q 032077           50 VVYATDEKRFVIPLAYL--KNNVIRELFKMAEDEFGLPSCG--PITLP-CDAVFMEYVVSLIQRG  109 (147)
Q Consensus        50 ~VYVGe~~RfvVp~~yL--nhP~F~~LL~~aeeEfG~~~~G--~L~IP-C~~~~Fe~vl~li~~~  109 (147)
                      .+.||++++|-+.-..|  ..|.|+.+++..    +....+  .+.++ ++...|+.++..+-.+
T Consensus        14 ~i~v~d~~~~~vhk~iL~~~S~~F~~~~~~~----~~~~~~~~~i~~~~~~~~~~~~~l~~~Y~~   74 (111)
T PF00651_consen   14 TIRVGDGKTFYVHKNILAARSPYFRNLFEGS----KFKESTVPEISLPDVSPEAFEAFLEYMYTG   74 (111)
T ss_dssp             EEEETTTEEEEE-HHHHHHHBHHHHHHHTTT----TSTTSSEEEEEETTSCHHHHHHHHHHHHHS
T ss_pred             EEEECCCEEEeechhhhhccchhhhhccccc----ccccccccccccccccccccccccccccCC
Confidence            45566688888887777  469999999888    222333  35555 7799999999988755


No 12 
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=54.01  E-value=24  Score=24.80  Aligned_cols=49  Identities=27%  Similarity=0.379  Sum_probs=34.4

Q ss_pred             EEEecCceeeeEeccCcCcHHHHHHHHHhHHhcCCCC------------CCCeeecCcHHHHHHH
Q 032077           50 VVYATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLPS------------CGPITLPCDAVFMEYV  102 (147)
Q Consensus        50 ~VYVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~~------------~G~L~IPC~~~~Fe~v  102 (147)
                      +.|-||-.||-+|..    .-|++|.++-.+-|+++.            +..++|.|+.++=|-+
T Consensus         5 ~~~~~d~~r~~l~~~----~~~~~L~~~i~~r~~~~~~~~f~LkY~Ddegd~v~ltsd~DL~eai   65 (82)
T cd06407           5 ATYGEEKIRFRLPPS----WGFTELKQEIAKRFKLDDMSAFDLKYLDDDEEWVLLTCDADLEECI   65 (82)
T ss_pred             EEeCCeEEEEEcCCC----CCHHHHHHHHHHHhCCCCCCeeEEEEECCCCCeEEeecHHHHHHHH
Confidence            456677899998853    368999998888887643            2346778887765543


No 13 
>PF07429 Glyco_transf_56:  4-alpha-L-fucosyltransferase glycosyl transferase group 56;  InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long). This catalyses the synthesis of Fuc4NAc-ManNAcA-GlcNAc-PP-Und (lipid III) as part of the biosynthetic pathway of enterobacterial common antigen (ECA), a polysaccharide comprised of the trisaccharide repeat unit Fuc4NAc-ManNAcA-GlcNAc [].; GO: 0008417 fucosyltransferase activity, 0009246 enterobacterial common antigen biosynthetic process, 0009276 Gram-negative-bacterium-type cell wall
Probab=52.62  E-value=67  Score=28.91  Aligned_cols=62  Identities=15%  Similarity=0.387  Sum_probs=38.9

Q ss_pred             ccCCCeEEEEecC---------------------ceeeeEeccCcC--cHHHHHHHHHhHHhcCCCCCCCeeecCcHHHH
Q 032077           43 VCEKGHFVVYATD---------------------EKRFVIPLAYLK--NNVIRELFKMAEDEFGLPSCGPITLPCDAVFM   99 (147)
Q Consensus        43 ~vpkG~~~VYVGe---------------------~~RfvVp~~yLn--hP~F~~LL~~aeeEfG~~~~G~L~IPC~~~~F   99 (147)
                      ..++|-+.|.||.                     ..|++||++|=.  .--..++.+.+++-||-   +-+.+-=+.--|
T Consensus       180 ~~~~~~ltILvGNSgd~sNnHieaL~~L~~~~~~~~kIivPLsYg~~n~~Yi~~V~~~~~~lF~~---~~~~iL~e~mpf  256 (360)
T PF07429_consen  180 KKNKGKLTILVGNSGDPSNNHIEALEALKQQFGDDVKIIVPLSYGANNQAYIQQVIQAGKELFGA---ENFQILTEFMPF  256 (360)
T ss_pred             cCCCCceEEEEcCCCCCCccHHHHHHHHHHhcCCCeEEEEECCCCCchHHHHHHHHHHHHHhcCc---cceeEhhhhCCH
Confidence            3456778888872                     389999999974  45666777777777882   333333333445


Q ss_pred             HHHHHHHh
Q 032077          100 EYVVSLIQ  107 (147)
Q Consensus       100 e~vl~li~  107 (147)
                      +..+.+|.
T Consensus       257 ~eYl~lL~  264 (360)
T PF07429_consen  257 DEYLALLS  264 (360)
T ss_pred             HHHHHHHH
Confidence            55555554


No 14 
>PF14317 YcxB:  YcxB-like protein
Probab=49.32  E-value=32  Score=20.98  Aligned_cols=32  Identities=22%  Similarity=0.389  Sum_probs=25.2

Q ss_pred             CCCeEEEEecCceeeeEeccCcCcHHHHHHHH
Q 032077           45 EKGHFVVYATDEKRFVIPLAYLKNNVIRELFK   76 (147)
Q Consensus        45 pkG~~~VYVGe~~RfvVp~~yLnhP~F~~LL~   76 (147)
                      -+.++.+|+++..-++||-+.++.--..++.+
T Consensus        28 ~~~~~~l~~~~~~~~~iPk~~f~~~e~~~f~~   59 (62)
T PF14317_consen   28 TKDYFYLYLGKNQAFIIPKRAFSEEEKEEFRE   59 (62)
T ss_pred             eCCEEEEEECCCeEEEEEHHHCCHhHHHHHHH
Confidence            36888899999999999999998555555443


No 15 
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl    5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and    metabolism]
Probab=40.58  E-value=14  Score=33.14  Aligned_cols=78  Identities=26%  Similarity=0.469  Sum_probs=46.8

Q ss_pred             CCccCCCeEEEEec-C--ceeeeEeccCcCc----------HHHHHHHHHhH----HhcCCC--CCCC------------
Q 032077           41 SSVCEKGHFVVYAT-D--EKRFVIPLAYLKN----------NVIRELFKMAE----DEFGLP--SCGP------------   89 (147)
Q Consensus        41 ~~~vpkG~~~VYVG-e--~~RfvVp~~yLnh----------P~F~~LL~~ae----eEfG~~--~~G~------------   89 (147)
                      ..-+|.|-|++||| |  .+.|.||+  +++          -.-..||++|.    +.|--.  -||+            
T Consensus        87 ~I~IP~gSfv~Y~G~d~ie~~~~vP~--fGnR~lLrwE~~~~~~~~lLekAgi~~P~~~~~PeeIdr~VIVK~pgAkggR  164 (361)
T COG1759          87 AIFIPHGSFVAYVGYDGIENEFEVPM--FGNRELLRWEEDRKLEYKLLEKAGLRIPKKYKSPEEIDRPVIVKLPGAKGGR  164 (361)
T ss_pred             eEEecCCceEEEecchhhhhcccCcc--cccHhHhhhhcchhhHHHHHHHcCCCCCcccCChHHcCCceEEecCCccCCc
Confidence            45689999999999 4  36677773  332          23457888874    122200  1232            


Q ss_pred             -eeecCcH-HHHHHHHHHHhcCch--HHHHHHHHh
Q 032077           90 -ITLPCDA-VFMEYVVSLIQRGAA--KDVEKALLM  120 (147)
Q Consensus        90 -L~IPC~~-~~Fe~vl~li~~~~~--~d~e~~~l~  120 (147)
                       --+.=+. ++.|.+-++++++.-  +|+++|-+-
T Consensus       165 GyFiA~s~eef~ek~e~l~~~gvi~~edlkna~Ie  199 (361)
T COG1759         165 GYFIASSPEEFYEKAERLLKRGVITEEDLKNARIE  199 (361)
T ss_pred             eEEEEcCHHHHHHHHHHHHHcCCcchhhhhhceee
Confidence             2344454 455666678887755  788777543


No 16 
>PF08948 DUF1859:  Domain of unknown function (DUF1859);  InterPro: IPR015043 This entry is represented by Bacteriophage PRD1, P5. This protein has no known function though it is sometimes found in the N terminus of bacteriophage spike proteins []. ; PDB: 1W8X_N.
Probab=40.35  E-value=13  Score=28.39  Aligned_cols=28  Identities=21%  Similarity=0.593  Sum_probs=9.0

Q ss_pred             CCCeEEEEecCceeee----------EeccCcCcHHHH
Q 032077           45 EKGHFVVYATDEKRFV----------IPLAYLKNNVIR   72 (147)
Q Consensus        45 pkG~~~VYVGe~~Rfv----------Vp~~yLnhP~F~   72 (147)
                      ..|||||.|-.+.+|+          +|+-|||.|+-+
T Consensus        86 ~QGYfPlL~~~~~KFv~~~~~~GKks~P~~FlNF~IA~  123 (126)
T PF08948_consen   86 KQGYFPLLVPGRAKFVVRHTGSGKKSVPMFFLNFTIAQ  123 (126)
T ss_dssp             --SS--EEE--SSSSEEEEEEEESS----S--------
T ss_pred             CcccceeeccchhhhhhhhccCCCcceeeEEEeceeee
Confidence            5799999997766666          688888887643


No 17 
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=37.69  E-value=1e+02  Score=22.00  Aligned_cols=56  Identities=18%  Similarity=0.296  Sum_probs=39.4

Q ss_pred             EEEecCceeeeEeccCcCcHHHHHHHHHhHHhcCCC---------CCCCeeecCcHHHHHHHHHHHhc
Q 032077           50 VVYATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLP---------SCGPITLPCDAVFMEYVVSLIQR  108 (147)
Q Consensus        50 ~VYVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~---------~~G~L~IPC~~~~Fe~vl~li~~  108 (147)
                      |-|-||..||.+|-  -.++-|.+|..+-+.-|+++         .+-+++|.|+.++=|. +++.++
T Consensus         5 aty~~d~~rf~~~~--~~~~~~~~L~~ev~~rf~l~~f~lKYlDde~e~v~lssd~eLeE~-~rl~~~   69 (81)
T cd06396           5 VTYNGESQSFLVSD--SENTTWASVEAMVKVSFGLNDIQIKYVDEENEEVSVNSQGEYEEA-LKSAVR   69 (81)
T ss_pred             EEECCeEEEEEecC--CCCCCHHHHHHHHHHHhCCCcceeEEEcCCCCEEEEEchhhHHHH-HHHHHh
Confidence            44668889999874  22567999999999999854         3356799998776544 334443


No 18 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=35.48  E-value=88  Score=22.63  Aligned_cols=46  Identities=24%  Similarity=0.400  Sum_probs=34.3

Q ss_pred             EecCceeeeEeccCcCcHHHHHHHHHhHHhcCCC----------CC-CCeeecCcHHHHHH
Q 032077           52 YATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLP----------SC-GPITLPCDAVFMEY  101 (147)
Q Consensus        52 YVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~----------~~-G~L~IPC~~~~Fe~  101 (147)
                      |-|+.+||.+|.    -|.+.+|-++-+.-|-+.          .| ..|||.=+.++.+.
T Consensus         7 ~~g~~RRf~~~~----~pt~~~L~~kl~~Lf~lp~~~~~vtYiDeD~D~ITlssd~eL~d~   63 (82)
T cd06397           7 FLGDTRRIVFPD----IPTWEALASKLENLYNLPEIKVGVTYIDNDNDEITLSSNKELQDF   63 (82)
T ss_pred             eCCceEEEecCC----CccHHHHHHHHHHHhCCChhHeEEEEEcCCCCEEEecchHHHHHH
Confidence            557889999998    899999999998877665          33 34677666555544


No 19 
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=34.57  E-value=74  Score=22.86  Aligned_cols=43  Identities=21%  Similarity=0.183  Sum_probs=28.4

Q ss_pred             EEEecCceeeeEeccCcCcHHHHHHHHHhHHhcCCC-------------CCCCe-eecCc
Q 032077           50 VVYATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLP-------------SCGPI-TLPCD   95 (147)
Q Consensus        50 ~VYVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~-------------~~G~L-~IPC~   95 (147)
                      +||-||-||+-+|.   +.-.|.+|.++....|...             .+|-+ ||.++
T Consensus         5 ~~~g~DiR~~~~~~---~~~t~~~L~~~v~~~F~~~~~~~~~flIKYkD~dGDlVTIts~   61 (81)
T cd06401           5 AQLGDDIRRIPIHN---EDITYDELLLMMQRVFRGKLGSSDDVLIKYKDEDGDLITIFDS   61 (81)
T ss_pred             EEeCCeEEEEeccC---ccccHHHHHHHHHHHhccccCCcccEEEEEECCCCCEEEeccH
Confidence            46666778866663   2236888999988777622             45664 67775


No 20 
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=33.71  E-value=65  Score=21.28  Aligned_cols=43  Identities=26%  Similarity=0.492  Sum_probs=29.0

Q ss_pred             EecCcee-eeEeccCcCcHHHHHHHHHhHHhcCCC----------CCCC-eeecCcHHH
Q 032077           52 YATDEKR-FVIPLAYLKNNVIRELFKMAEDEFGLP----------SCGP-ITLPCDAVF   98 (147)
Q Consensus        52 YVGe~~R-fvVp~~yLnhP~F~~LL~~aeeEfG~~----------~~G~-L~IPC~~~~   98 (147)
                      |.|+.+| +.+|    ..+.|.+|..+.++.||..          .+|- ++|.++.++
T Consensus         8 ~~~~~~~~~~~~----~~~s~~~L~~~i~~~~~~~~~~~~l~Y~D~dgD~V~i~sd~Dl   62 (84)
T PF00564_consen    8 YGGDIRRIISLP----SDVSFDDLRSKIREKFGLLDEDFQLKYKDEDGDLVTISSDEDL   62 (84)
T ss_dssp             ETTEEEEEEEEC----STSHHHHHHHHHHHHHTTSTSSEEEEEEETTSSEEEESSHHHH
T ss_pred             ECCeeEEEEEcC----CCCCHHHHHHHHHHHhCCCCccEEEEeeCCCCCEEEeCCHHHH
Confidence            3345555 4444    5679999999999999983          4453 566666543


No 21 
>PF02209 VHP:  Villin headpiece domain;  InterPro: IPR003128 Villin is an F-actin bundling protein involved in the maintenance of the microvilli of the absorptive epithelia. The villin-type "headpiece" domain is a modular motif found at the extreme C terminus of larger "core" domains in over 25 cytoskeletal proteins in plants and animals, often in assocation with the Gelsolin repeat. Although the headpiece is classified as an F-actin-binding domain, it has been shown that not all headpiece domains are intrinsically F-actin-binding motifs, surface charge distribution may be an important element for F-actin recognition []. An autonomously folding, 35 residue, thermostable subdomain (HP36) of the full-length 76 amino acid residue villin headpiece, is the smallest known example of a cooperatively folded domain of a naturally occurring protein. The structure of HP36, as determined by NMR spectroscopy, consists of three short helices surrounding a tightly packed hydrophobic core []. ; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1ZV6_A 1QZP_A 1UND_A 2PPZ_A 3TJW_B 1YU8_X 2JM0_A 1WY4_A 3MYC_A 1YU5_X ....
Probab=33.01  E-value=18  Score=22.09  Aligned_cols=19  Identities=32%  Similarity=0.658  Sum_probs=15.1

Q ss_pred             CcCcHHHHHHHHHhHHhcC
Q 032077           65 YLKNNVIRELFKMAEDEFG   83 (147)
Q Consensus        65 yLnhP~F~~LL~~aeeEfG   83 (147)
                      ||+.-.|.+++.++.+||.
T Consensus         1 YLsd~dF~~vFgm~~~eF~   19 (36)
T PF02209_consen    1 YLSDEDFEKVFGMSREEFY   19 (36)
T ss_dssp             GS-HHHHHHHHSS-HHHHH
T ss_pred             CcCHHHHHHHHCCCHHHHH
Confidence            7889999999999999983


No 22 
>PF06849 DUF1246:  Protein of unknown function (DUF1246);  InterPro: IPR010672 The last two steps of de novo purine biosynthesis are:  i) conversion of 5-aminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (AICAR) to 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate (FAICAR) ii) conversion of FAICAR to inosine5'-monophopsphate (IMP)  In bacteria and eukaryotes, these steps are catalysed by the well-characterised bifunctional enzyme PurH []. Archaea do not appear to posses PurH, however, and perform these reactions by a different mecahnism []. In archaea, step i) is catalysed by the well-conserved PurP protein, while step ii) is catalysed by the PurO enzyme in some (though not all) species [, ]. This entry represents the N-terminal domain of PurP. Its function is not known, though it is almost always found in association with IPR009720 from INTERPRO.; GO: 0000287 magnesium ion binding, 0005524 ATP binding, 0016879 ligase activity, forming carbon-nitrogen bonds, 0006188 IMP biosynthetic process; PDB: 2PBZ_C 2R85_B 2R87_E 2R84_A 2R86_A 2R7L_A 2R7N_A 2R7K_A 2R7M_A.
Probab=32.58  E-value=2.2  Score=32.89  Aligned_cols=23  Identities=35%  Similarity=0.746  Sum_probs=13.6

Q ss_pred             CCccCCCeEEEEec-C--ceeeeEec
Q 032077           41 SSVCEKGHFVVYAT-D--EKRFVIPL   63 (147)
Q Consensus        41 ~~~vpkG~~~VYVG-e--~~RfvVp~   63 (147)
                      ..-||.|-|++||| |  .++|-||+
T Consensus        67 ~I~VPhgSfv~Y~G~d~ie~~~~vP~   92 (124)
T PF06849_consen   67 AIFVPHGSFVAYVGYDRIENEFKVPI   92 (124)
T ss_dssp             EEE--BTTHHHHH-HHHHHHT-SS-E
T ss_pred             eEEecCCCeeEeecHHHHhhcCCCCe
Confidence            45689999999999 4  35577774


No 23 
>smart00153 VHP Villin headpiece domain.
Probab=32.07  E-value=24  Score=21.50  Aligned_cols=19  Identities=37%  Similarity=0.691  Sum_probs=16.9

Q ss_pred             CcCcHHHHHHHHHhHHhcC
Q 032077           65 YLKNNVIRELFKMAEDEFG   83 (147)
Q Consensus        65 yLnhP~F~~LL~~aeeEfG   83 (147)
                      ||+.-.|+.++.++.+||-
T Consensus         1 yLsdeeF~~vfgmsr~eF~   19 (36)
T smart00153        1 YLSDEDFEEVFGMTREEFY   19 (36)
T ss_pred             CCCHHHHHHHHCCCHHHHH
Confidence            7889999999999999983


No 24 
>PF12058 DUF3539:  Protein of unknown function (DUF3539);  InterPro: IPR021926  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 90 amino acids in length. This protein has a conserved NHP sequence motif. ; PDB: 3N5B_B 2XKO_C 2XG8_F.
Probab=32.04  E-value=7.4  Score=28.45  Aligned_cols=14  Identities=21%  Similarity=0.574  Sum_probs=9.8

Q ss_pred             cCcCcHHHHHHHHH
Q 032077           64 AYLKNNVIRELFKM   77 (147)
Q Consensus        64 ~yLnhP~F~~LL~~   77 (147)
                      .|||||.|..|-.-
T Consensus         4 ~YLNHPtFGlLy~V   17 (88)
T PF12058_consen    4 TYLNHPTFGLLYRV   17 (88)
T ss_dssp             -EEEETTTEEEEEE
T ss_pred             ccccCCccchheee
Confidence            58999998776543


No 25 
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=31.61  E-value=89  Score=22.38  Aligned_cols=52  Identities=25%  Similarity=0.337  Sum_probs=35.0

Q ss_pred             EecCceeeeEeccC-cCcHHHHHHHHHhHHhcCCCC-----------CCC-eeecCcHHHHHHHH
Q 032077           52 YATDEKRFVIPLAY-LKNNVIRELFKMAEDEFGLPS-----------CGP-ITLPCDAVFMEYVV  103 (147)
Q Consensus        52 YVGe~~RfvVp~~y-LnhP~F~~LL~~aeeEfG~~~-----------~G~-L~IPC~~~~Fe~vl  103 (147)
                      |-|+-+||-+|.+= -.+.-|..|.++-++-|....           +|- ++|.|+.++-+-+-
T Consensus         7 y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l~~~~~~~l~Y~Dedgd~V~l~~D~DL~~a~~   71 (91)
T cd06398           7 YGGTLRRFTFPVAENQLDLNMDGLREKVEELFSLSPDADLSLTYTDEDGDVVTLVDDNDLTDAIQ   71 (91)
T ss_pred             eCCEEEEEEeccccccCCCCHHHHHHHHHHHhCCCCCCcEEEEEECCCCCEEEEccHHHHHHHHH
Confidence            44678999999740 114578888888888876653           343 57888876655543


No 26 
>COG4923 Predicted nuclease (RNAse H fold) [General function prediction only]
Probab=30.76  E-value=70  Score=27.08  Aligned_cols=14  Identities=21%  Similarity=0.622  Sum_probs=11.3

Q ss_pred             CeeecCcHHHHHHH
Q 032077           89 PITLPCDAVFMEYV  102 (147)
Q Consensus        89 ~L~IPC~~~~Fe~v  102 (147)
                      ..++||.+..+..+
T Consensus        88 vF~vPcR~A~Y~~~  101 (245)
T COG4923          88 VFSVPCRAALYSDI  101 (245)
T ss_pred             eeccchHHHHHHHH
Confidence            35799999888776


No 27 
>PF00191 Annexin:  Annexin;  InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner []. They are distributed ubiquitously in different tissues and cell types of higher and lower eukaryotes, including mammals, fish, birds, Drosophila melanogaster (Fruit fly), Xenopus laevis (African clawed frog), Caenorhabditis elegans , Dictyostelium discoideum (Slime mold) and Neurospora crassa [, ]. Annexins are absent from yeasts and prokaryotes []. The plant annexins are somewhat distinct from those found in other taxa []. Most eukaryotic species have 1-20 annexin (ANX) genes. All annexins share a core domain made up of four similar repeats, each approximately 70 amino acids long []. Each individual annexin repeat (sometimes referred to as endonexin folds) is folded into five alpha-helices, and in turn are wound into a right-handed super-helix; they usually contain a characteristic 'type 2' motif for binding calcium ions with the sequence 'GxGT-[38 residues]-D/E'. Animal and fungal annexins also have variable amino-terminal domains. The core domains of most vertebrate annexins have been analysed by X-ray crystallography, revealing conservation of their secondary and tertiary structures despite only 45-55% amino-acid identity among individual members. The four repeats pack into a structure that resembles a flattened disc, with a slightly convex surface on which the Ca 2+ -binding loops are located and a concave surface at which the amino and carboxyl termini come into close apposition. Annexins are traditionally thought of as calcium-dependent phospholipid-binding proteins, but recent work suggests a more complex set of functions. The famiy has been linked with inhibition of phospholipase activity, exocytosis and endoctyosis, signal transduction, organisation of the extracellular matrix, resistance to reactive oxygen species and DNA replication [].; GO: 0005509 calcium ion binding, 0005544 calcium-dependent phospholipid binding; PDB: 1N44_A 1BC1_A 2IE6_A 2H0M_A 1A8B_A 2H0K_A 1BCW_A 1BCZ_A 1N42_A 1BC0_A ....
Probab=30.50  E-value=77  Score=20.07  Aligned_cols=37  Identities=22%  Similarity=0.341  Sum_probs=23.8

Q ss_pred             cHHHHHHHHHhHHhcCCCCCCCeeecCcHHHHHHHHHHHhcCchHHHHHHHHh
Q 032077           68 NNVIRELFKMAEDEFGLPSCGPITLPCDAVFMEYVVSLIQRGAAKDVEKALLM  120 (147)
Q Consensus        68 hP~F~~LL~~aeeEfG~~~~G~L~IPC~~~~Fe~vl~li~~~~~~d~e~~~l~  120 (147)
                      .+-.+++.+.-+..||                ..+...|+++.+.|++++||+
T Consensus        29 ~~ql~~i~~~Y~~~~g----------------~~L~~~i~~e~sGd~~~~Ll~   65 (66)
T PF00191_consen   29 PAQLRAIKQAYKKKYG----------------KDLEEDIKKETSGDFEKLLLA   65 (66)
T ss_dssp             HHHHHHHHHHHHHHHS----------------S-HHHHHHHHSTHHHHHHHHH
T ss_pred             ccccceeehhhhhhhH----------------HHHHHHHHHhCCHHHHHHHHh
Confidence            3445555555555666                235567788888899988874


No 28 
>PF11834 DUF3354:  Domain of unknown function (DUF3354);  InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement. Inward rectifying potassium (K(+)in) channels play an important role in turgor regulation and ion uptake in higher plants. All of them comprise, from their N-terminal to their C-terminal ends: a short hydrophilic region, a hydrophobic region structurally analogous and partially homologous to the transmembrane domain of voltage-gated animal channels from the Shaker superfamily, a putative cyclic nucleotide-binding domain, and a conserved C-terminal KHA domain. Between these last two regions, some of them (AKT1, AKT2 and SKT1) contain an ankyrin-repeat domain with six repeats homologous to those of human erythrocyte ankyrin.  This entry represents the KHA domain which is unique to plant K(+)in channels. The KHA domain contains two high-homology blocks enriched for hydrophobic and acidic residues, respectively. The KHA domain is essential for interaction of plant K(+)in channels. The KHA domain mediates tetramerization and/or stabilisation of the heteromers [, , ]. 
Probab=30.43  E-value=40  Score=23.26  Aligned_cols=17  Identities=35%  Similarity=0.827  Sum_probs=15.3

Q ss_pred             HHHHHHHHHhHHhcCCC
Q 032077           69 NVIRELFKMAEDEFGLP   85 (147)
Q Consensus        69 P~F~~LL~~aeeEfG~~   85 (147)
                      -.+++||+.|++.||+.
T Consensus        26 ~SleeLl~ia~~kfg~~   42 (69)
T PF11834_consen   26 DSLEELLKIASEKFGFS   42 (69)
T ss_pred             ccHHHHHHHHHHHhCCC
Confidence            36999999999999985


No 29 
>COG4862 MecA Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion]
Probab=29.35  E-value=37  Score=28.67  Aligned_cols=27  Identities=15%  Similarity=0.247  Sum_probs=24.2

Q ss_pred             CcHHHHHHHHHhHHhcCCCCCCCeeec
Q 032077           67 KNNVIRELFKMAEDEFGLPSCGPITLP   93 (147)
Q Consensus        67 nhP~F~~LL~~aeeEfG~~~~G~L~IP   93 (147)
                      .|-+|-++++.+..|-+|..+|||.|-
T Consensus        37 ~EE~F~~mMdEl~~ee~F~~~GpL~iq   63 (224)
T COG4862          37 TEELFYEMMDELNLEEDFKDEGPLWIQ   63 (224)
T ss_pred             HHHHHHHHHHhcCCccccccCCceEEE
Confidence            478999999999999999999999763


No 30 
>PF11822 DUF3342:  Domain of unknown function (DUF3342);  InterPro: IPR021777  This family of proteins are functionally uncharacterised. This family is found in bacteria. This presumed domain is typically between 170 to 303 amino acids in length. The N-terminal half of this family is a BTB-like domain. 
Probab=27.23  E-value=69  Score=28.31  Aligned_cols=52  Identities=15%  Similarity=0.336  Sum_probs=40.1

Q ss_pred             ceeeeEeccCcC--cHHHHHHHHH---hHHhcCCCCCCCeeecCcHHHHHHHHHHHhcCc
Q 032077           56 EKRFVIPLAYLK--NNVIRELFKM---AEDEFGLPSCGPITLPCDAVFMEYVVSLIQRGA  110 (147)
Q Consensus        56 ~~RfvVp~~yLn--hP~F~~LL~~---aeeEfG~~~~G~L~IPC~~~~Fe~vl~li~~~~  110 (147)
                      .+=|..|.+.|-  ..-|++.|..   ...+.   .+=.|.+-||+..|+.++..+++..
T Consensus        13 ~rdF~C~~~lL~~~M~YF~~~l~~~~~~~~~~---~~idisVhCDv~iF~WLm~yv~~~~   69 (317)
T PF11822_consen   13 KRDFTCPRDLLVSEMRYFAEYLSRYINDSQRW---EEIDISVHCDVHIFEWLMRYVKGEP   69 (317)
T ss_pred             ceeeeccHHHHHHhhHHHHHHHhhcccccCcC---CCcceEEecChhHHHHHHHHhhcCC
Confidence            577889988874  4679999976   33332   2456889999999999999999854


No 31 
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional
Probab=27.14  E-value=27  Score=31.34  Aligned_cols=26  Identities=27%  Similarity=0.535  Sum_probs=19.6

Q ss_pred             CCccCCCeEEEEec-Cc--eeeeEeccCcCc
Q 032077           41 SSVCEKGHFVVYAT-DE--KRFVIPLAYLKN   68 (147)
Q Consensus        41 ~~~vpkG~~~VYVG-e~--~RfvVp~~yLnh   68 (147)
                      ..-||.|-|++||| |+  ..|-||  ++++
T Consensus        87 ~i~iPh~sf~~y~g~~~ie~~~~vp--~fGn  115 (366)
T PRK13277         87 AIFVPNRSFAVYVGYDAIENEFKVP--IFGN  115 (366)
T ss_pred             eEEecCCCeEEEecHHHHhhcCCCC--cccC
Confidence            45689999999999 42  478888  4444


No 32 
>PF04332 DUF475:  Protein of unknown function (DUF475);  InterPro: IPR007427 This entry contains proteins that are predicted to be an integral membrane proteins with multiple transmembrane domains.
Probab=25.23  E-value=45  Score=29.23  Aligned_cols=16  Identities=31%  Similarity=0.569  Sum_probs=14.6

Q ss_pred             CChHHHHHHHHHHhhh
Q 032077            2 ISPKKLIKMSKKWQKL   17 (147)
Q Consensus         2 ~~~~kL~~~akKWqk~   17 (147)
                      +|++.|+.|..+|||+
T Consensus         6 VNA~vLk~Ms~~Wq~~   21 (294)
T PF04332_consen    6 VNATVLKRMSPFWQRR   21 (294)
T ss_pred             hhHHHHHhhhHHHHHH
Confidence            7899999999999974


No 33 
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=24.14  E-value=44  Score=31.74  Aligned_cols=19  Identities=21%  Similarity=0.240  Sum_probs=16.0

Q ss_pred             cCCCeEEEEecC---ceeeeEe
Q 032077           44 CEKGHFVVYATD---EKRFVIP   62 (147)
Q Consensus        44 vpkG~~~VYVGe---~~RfvVp   62 (147)
                      .+-||.||++||   ..||+|-
T Consensus        62 ~kGGYHpV~IGD~F~~gRY~v~   83 (590)
T KOG1290|consen   62 RKGGYHPVRIGDVFNGGRYHVQ   83 (590)
T ss_pred             hcCCCceeeccccccCceEEEE
Confidence            578999999998   4899874


No 34 
>PRK02797 4-alpha-L-fucosyltransferase; Provisional
Probab=22.96  E-value=1.7e+02  Score=25.95  Aligned_cols=62  Identities=13%  Similarity=0.312  Sum_probs=37.8

Q ss_pred             ccCCCeEEEEecC---------------------ceeeeEeccCc-CcHHHH-HHHHHhHHhcCCCCCCCeeecCcHHHH
Q 032077           43 VCEKGHFVVYATD---------------------EKRFVIPLAYL-KNNVIR-ELFKMAEDEFGLPSCGPITLPCDAVFM   99 (147)
Q Consensus        43 ~vpkG~~~VYVGe---------------------~~RfvVp~~yL-nhP~F~-~LL~~aeeEfG~~~~G~L~IPC~~~~F   99 (147)
                      ..++|-+.|.||.                     .-|++||++|= |+.... +..+.+.+-||-   +-+.+-=+---|
T Consensus       141 ~~~~~~~tIlvGNSgd~SN~Hie~L~~l~~~~~~~v~ii~PlsYp~gn~~Yi~~V~~~~~~lF~~---~~~~~L~e~l~f  217 (322)
T PRK02797        141 RQRAGKMTILVGNSGDRSNRHIEALRALHQQFGDNVKIIVPMGYPANNQAYIEEVRQAGLALFGA---ENFQILTEKLPF  217 (322)
T ss_pred             ccCCCceEEEEeCCCCCcccHHHHHHHHHHHhCCCeEEEEECCcCCCCHHHHHHHHHHHHHhcCc---ccEEehhhhCCH
Confidence            4467789999972                     25999999994 455554 455555555762   334444444445


Q ss_pred             HHHHHHHh
Q 032077          100 EYVVSLIQ  107 (147)
Q Consensus       100 e~vl~li~  107 (147)
                      +..+.+|.
T Consensus       218 ~eYl~lL~  225 (322)
T PRK02797        218 DDYLALLR  225 (322)
T ss_pred             HHHHHHHH
Confidence            55555554


No 35 
>cd04751 Commd3 COMM_Domain containing protein 3. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=22.14  E-value=96  Score=22.15  Aligned_cols=29  Identities=21%  Similarity=0.400  Sum_probs=22.8

Q ss_pred             CCCeeecCcHHHHHHHHHHHhcCchHHHHH
Q 032077           87 CGPITLPCDAVFMEYVVSLIQRGAAKDVEK  116 (147)
Q Consensus        87 ~G~L~IPC~~~~Fe~vl~li~~~~~~d~e~  116 (147)
                      .+.+.+-|+++-|.+++.-|+.. .+.+|+
T Consensus        64 ~~~i~f~c~~e~L~~Li~~Lk~A-~~~~e~   92 (95)
T cd04751          64 KPDINFTCTLEQLQDLVNKLKDA-AKNIER   92 (95)
T ss_pred             cceEEEEeCHHHHHHHHHHHHHH-HHHHHH
Confidence            35899999999999999998543 456664


No 36 
>cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins. ArhGAP21 is a multi-domain protein, containing RhoGAP, PH and PDZ domains, and is believed to play a role in the organization of the cell-cell junction complex. It has been shown to function as a GAP of Cdc42 and RhoA, and to interact with alpha-catenin and Arf6. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=21.93  E-value=2e+02  Score=22.51  Aligned_cols=42  Identities=19%  Similarity=0.276  Sum_probs=34.2

Q ss_pred             HHHHHHHHHhHHhcCCCCCCCeeecCcHHHHHHHHHHHhcCc
Q 032077           69 NVIRELFKMAEDEFGLPSCGPITLPCDAVFMEYVVSLIQRGA  110 (147)
Q Consensus        69 P~F~~LL~~aeeEfG~~~~G~L~IPC~~~~Fe~vl~li~~~~  110 (147)
                      |.|.+..-..-++.|.+.+|--++|.+...-+.+...++++.
T Consensus        19 P~iv~~~~~~l~~~g~~~eGIFR~~g~~~~i~~l~~~l~~~~   60 (196)
T cd04395          19 PLIVEVCCNIVEARGLETVGIYRVPGNNAAISALQEELNRGG   60 (196)
T ss_pred             ChHHHHHHHHHHHcCCCCccceeCCCcHHHHHHHHHHHhcCC
Confidence            455544445567889999999999999999999999999875


No 37 
>COG2899 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=21.19  E-value=47  Score=29.46  Aligned_cols=16  Identities=38%  Similarity=0.515  Sum_probs=14.6

Q ss_pred             CChHHHHHHHHHHhhh
Q 032077            2 ISPKKLIKMSKKWQKL   17 (147)
Q Consensus         2 ~~~~kL~~~akKWqk~   17 (147)
                      +|+.+|+.|..+|||+
T Consensus        56 vNA~iLk~MS~~Wqk~   71 (346)
T COG2899          56 VNAAILKDMSPFWQKR   71 (346)
T ss_pred             hhHHHHHhccHHHHHH
Confidence            6899999999999985


No 38 
>cd01406 SIR2-like Sir2-like: Prokaryotic group of uncharacterized Sir2-like proteins which lack certain key catalytic residues and conserved zinc binding cysteines; and are members of the SIR2 superfamily of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation.
Probab=20.82  E-value=1.7e+02  Score=23.42  Aligned_cols=34  Identities=18%  Similarity=0.204  Sum_probs=27.1

Q ss_pred             CeEEEEecCc--eeeeEeccCcCcHHHHHHHHHhHHhcCCCCC
Q 032077           47 GHFVVYATDE--KRFVIPLAYLKNNVIRELFKMAEDEFGLPSC   87 (147)
Q Consensus        47 G~~~VYVGe~--~RfvVp~~yLnhP~F~~LL~~aeeEfG~~~~   87 (147)
                      |++++++|-+  .+       .+-|.+.+|++...+++|.+.+
T Consensus         1 g~lvlFiGAG~S~~-------~glP~W~~Ll~~l~~~~~~~~~   36 (242)
T cd01406           1 GRVVIFVGAGVSVS-------SGLPDWKTLLDEIASELGLEID   36 (242)
T ss_pred             CCEEEEecCccccc-------cCCCChHHHHHHHHHHcCCccc
Confidence            7888999853  22       4788999999999999987644


No 39 
>PF05194 UreE_C:  UreE urease accessory protein, C-terminal domain;  InterPro: IPR007864 Urease and other nickel metalloenzymes are synthesised as precursors devoid of the metalloenzyme active site. These precursors then undergo a complex post-translational maturation process that requires a number of accessory proteins. Members of this group are nickel-binding proteins required for urease metallocentre assembly []. They are believed to function as metallochaperones to deliver nickel to urease apoprotein [, ]. It has been shown by yeast two-hybrid analysis that UreE forms a dimeric complex with UreG in Helicobacter pylori []. The UreDFG-apoenzyme complex has also been shown to exist [, ] and is believed to be, with the addition of UreE, the assembly system for active urease []. The complexes, rather than the individual proteins, presumably bind to UreB via UreE/H recognition sites. The structure of Klebsiella aerogenes UreE reveals a unique two-domain architecture.The N-terminal domain is structurally related to a heat shock protein, while the C-terminal domain shows homology to the Atx1 copper metallochaperone [, ]. Significantly, the metal-binding sites in UreE and Atx1 are distinct in location and types of residues despite the relationship between these proteins and the mechanism for UreE activation of urease is proposed to be different from the thiol ligand exchange mechanism used by the copper metallochaperones. The C-terminal domain of this protein is the metal-binding region, which can bind up to six Ni molecules per dimer. Most members of this group contain a histidine-rich C-terminal motif that is involved in, but not solely responsible for, binding nickel ions in K. aerogenes UreE []. However, internal ligands, not the histidine residues at the C terminus, are necessary for UreE to assist in urease activation in K. aerogenes [], even though the truncated protein lacking the His-rich region binds two nickel ions instead of six. In H. pylori and some other organisms, the terminal histidine-rich binding sites are absent, but the internal histidine sites are present, and the latter probably function as nickel donors. Deletion analysis shows that this domain alone is sufficient for metal-binding and activation of urease [].; GO: 0016151 nickel ion binding, 0006461 protein complex assembly, 0019627 urea metabolic process; PDB: 3NXZ_B 3TJA_B 3LA0_B 3TJ9_B 3NY0_A 3L9Z_A 3TJ8_A 1EAR_A 1EB0_A 1GMU_B ....
Probab=20.71  E-value=1.4e+02  Score=20.71  Aligned_cols=28  Identities=18%  Similarity=0.579  Sum_probs=17.8

Q ss_pred             CCeEEEEecCceeeeEeccCcCcHHHHHHHHHh
Q 032077           46 KGHFVVYATDEKRFVIPLAYLKNNVIRELFKMA   78 (147)
Q Consensus        46 kG~~~VYVGe~~RfvVp~~yLnhP~F~~LL~~a   78 (147)
                      .=|+|+++++. ++.||    ..+...+||++.
T Consensus        24 NrH~p~~i~~~-~l~v~----~d~~l~~~L~~l   51 (87)
T PF05194_consen   24 NRHWPLFIEED-ELYVP----YDHVLEELLRKL   51 (87)
T ss_dssp             HTT--EEEETT-EEEEE------HHHHHHHHHT
T ss_pred             CCccceEEcCC-EEEec----CcHHHHHHHHHC
Confidence            45888998876 77777    566777777774


No 40 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=20.33  E-value=2e+02  Score=20.79  Aligned_cols=38  Identities=24%  Similarity=0.199  Sum_probs=29.0

Q ss_pred             EEecCceeeeEeccCcCcHHHHHHHHHhHHhcCCCCCCCeee
Q 032077           51 VYATDEKRFVIPLAYLKNNVIRELFKMAEDEFGLPSCGPITL   92 (147)
Q Consensus        51 VYVGe~~RfvVp~~yLnhP~F~~LL~~aeeEfG~~~~G~L~I   92 (147)
                      -|-||-.++-++.    ...|.+|.++-++-|.|..++++++
T Consensus         6 ~y~gdi~it~~d~----~~s~e~L~~~v~~~c~~~~~q~ft~   43 (83)
T cd06404           6 AYNGDIMITSIDP----SISLEELCNEVRDMCRFHNDQPFTL   43 (83)
T ss_pred             EecCcEEEEEcCC----CcCHHHHHHHHHHHhCCCCCCcEEE
Confidence            3556655555554    4559999999999999998888876


No 41 
>cd06080 MUM1_like Mutated melanoma-associated antigen 1 (MUM-1) is a melanoma-associated antigen (MAA).  MUM-1 belongs to the mutated or aberrantly expressed type of MAAs, along with antigens such as CDK4, beta-catenin, gp100-in4, p15, and N-acetylglucosaminyltransferase V.  It is highly expressed in several types of human cancers.  The PWWP domain, named for a conserved Pro-Trp-Trp-Pro motif, is a small domain consisting of 100-150 amino acids. The PWWP domain is found in numerous proteins that are involved in cell division, growth and differentiation. Most PWWP-domain proteins seem to be nuclear, often DNA-binding, proteins that function as transcription factors regulating a variety of developmental processes.
Probab=20.07  E-value=1.5e+02  Score=20.88  Aligned_cols=39  Identities=18%  Similarity=0.237  Sum_probs=31.8

Q ss_pred             CCCeEEEEecCc-----eeeeEeccCcCcHHH---HHHHHHhHHhcC
Q 032077           45 EKGHFVVYATDE-----KRFVIPLAYLKNNVI---RELFKMAEDEFG   83 (147)
Q Consensus        45 pkG~~~VYVGe~-----~RfvVp~~yLnhP~F---~~LL~~aeeEfG   83 (147)
                      ++-+.+.+.|+.     .++-+...|+.|+.+   +.|++++.|.|.
T Consensus        28 ~~k~~V~FfG~~~~~a~~~~~~l~p~~~~~~~~ek~~~~~k~ke~~~   74 (80)
T cd06080          28 KQKARVNFIGDNMQSEKKGIRVVKRWLKHFDCTEKQKLTNKAKESYE   74 (80)
T ss_pred             CCEEEEEEeCCCCceeccchhhcccccccHHHHHHHHHHHHHHHHHH
Confidence            455667778864     778888899999999   489999999886


Done!