BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032082
(147 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|B Chain B, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|C Chain C, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|D Chain D, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|E Chain E, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|F Chain F, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|G Chain G, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|H Chain H, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|I Chain I, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex.
pdb|1ZY8|J Chain J, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
And Dihydrolipoamide Dehydrogenase-Binding Protein
(Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
Complex
Length = 474
Score = 26.9 bits (58), Expect = 4.5, Method: Composition-based stats.
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
Query: 4 GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
G+ T+V++ L + P K + ++ GV+G +GS+W RLG D
Sbjct: 157 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 203
>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMC|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nad+
pdb|1ZMD|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|1ZMD|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
Complexed To Nadh
pdb|2F5Z|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|I Chain I, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
pdb|2F5Z|J Chain J, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
(E3) Complexed To The E3-Binding Domain Of Human E3-
Binding Protein
Length = 474
Score = 26.9 bits (58), Expect = 4.5, Method: Composition-based stats.
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
Query: 4 GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
G+ T+V++ L + P K + ++ GV+G +GS+W RLG D
Sbjct: 157 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 203
>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human
Dihydrolipoamide Transacylase (E2b) Bound To Human
Dihydrolipoamide Dehydrogenase (E3)
pdb|3RNM|B Chain B, The Crystal Structure Of The Subunit Binding Of Human
Dihydrolipoamide Transacylase (E2b) Bound To Human
Dihydrolipoamide Dehydrogenase (E3)
pdb|3RNM|C Chain C, The Crystal Structure Of The Subunit Binding Of Human
Dihydrolipoamide Transacylase (E2b) Bound To Human
Dihydrolipoamide Dehydrogenase (E3)
pdb|3RNM|D Chain D, The Crystal Structure Of The Subunit Binding Of Human
Dihydrolipoamide Transacylase (E2b) Bound To Human
Dihydrolipoamide Dehydrogenase (E3)
Length = 495
Score = 26.9 bits (58), Expect = 4.5, Method: Composition-based stats.
Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
Query: 4 GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
G+ T+V++ L + P K + ++ GV+G +GS+W RLG D
Sbjct: 178 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 224
>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
From Pisum Sativum
pdb|1DXL|B Chain B, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
From Pisum Sativum
pdb|1DXL|C Chain C, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
From Pisum Sativum
pdb|1DXL|D Chain D, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
From Pisum Sativum
Length = 470
Score = 26.2 bits (56), Expect = 8.0, Method: Composition-based stats.
Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 10/64 (15%)
Query: 4 GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVDWGLSIFLCTIV 62
GV K +V++ L + P K + ++ G +G MGS+W R+G + T+V
Sbjct: 156 GVTIDEKKIVSSTGALALSEIPKKLV--VIGAGYIGLEMGSVWGRIGSE-------VTVV 206
Query: 63 VFAS 66
FAS
Sbjct: 207 EFAS 210
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.335 0.145 0.457
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,700,001
Number of Sequences: 62578
Number of extensions: 126722
Number of successful extensions: 393
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 392
Number of HSP's gapped (non-prelim): 7
length of query: 147
length of database: 14,973,337
effective HSP length: 90
effective length of query: 57
effective length of database: 9,341,317
effective search space: 532455069
effective search space used: 532455069
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 47 (22.7 bits)