BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032082
         (147 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1ZY8|A Chain A, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|B Chain B, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|C Chain C, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|D Chain D, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|E Chain E, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|F Chain F, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|G Chain G, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|H Chain H, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|I Chain I, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex.
 pdb|1ZY8|J Chain J, The Crystal Structure Of Dihydrolipoamide Dehydrogenase
           And Dihydrolipoamide Dehydrogenase-Binding Protein
           (Didomain) Subcomplex Of Human Pyruvate Dehydrogenase
           Complex
          Length = 474

 Score = 26.9 bits (58), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 4   GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
           G+     T+V++   L +   P K +  ++  GV+G  +GS+W RLG D
Sbjct: 157 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 203


>pdb|1ZMC|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMC|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nad+
 pdb|1ZMD|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|1ZMD|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           Complexed To Nadh
 pdb|2F5Z|A Chain A, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|B Chain B, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|C Chain C, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|D Chain D, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|E Chain E, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|F Chain F, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|G Chain G, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|H Chain H, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|I Chain I, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
 pdb|2F5Z|J Chain J, Crystal Structure Of Human Dihydrolipoamide Dehydrogenase
           (E3) Complexed To The E3-Binding Domain Of Human E3-
           Binding Protein
          Length = 474

 Score = 26.9 bits (58), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 4   GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
           G+     T+V++   L +   P K +  ++  GV+G  +GS+W RLG D
Sbjct: 157 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 203


>pdb|3RNM|A Chain A, The Crystal Structure Of The Subunit Binding Of Human
           Dihydrolipoamide Transacylase (E2b) Bound To Human
           Dihydrolipoamide Dehydrogenase (E3)
 pdb|3RNM|B Chain B, The Crystal Structure Of The Subunit Binding Of Human
           Dihydrolipoamide Transacylase (E2b) Bound To Human
           Dihydrolipoamide Dehydrogenase (E3)
 pdb|3RNM|C Chain C, The Crystal Structure Of The Subunit Binding Of Human
           Dihydrolipoamide Transacylase (E2b) Bound To Human
           Dihydrolipoamide Dehydrogenase (E3)
 pdb|3RNM|D Chain D, The Crystal Structure Of The Subunit Binding Of Human
           Dihydrolipoamide Transacylase (E2b) Bound To Human
           Dihydrolipoamide Dehydrogenase (E3)
          Length = 495

 Score = 26.9 bits (58), Expect = 4.5,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 3/49 (6%)

Query: 4   GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVD 51
           G+     T+V++   L +   P K +  ++  GV+G  +GS+W RLG D
Sbjct: 178 GITIDEDTIVSSTGALSLKKVPEKMV--VIGAGVIGVELGSVWQRLGAD 224


>pdb|1DXL|A Chain A, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
           From Pisum Sativum
 pdb|1DXL|B Chain B, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
           From Pisum Sativum
 pdb|1DXL|C Chain C, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
           From Pisum Sativum
 pdb|1DXL|D Chain D, Dihydrolipoamide Dehydrogenase Of Glycine Decarboxylase
           From Pisum Sativum
          Length = 470

 Score = 26.2 bits (56), Expect = 8.0,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 10/64 (15%)

Query: 4   GVAAGRKTMVATAMLLLVLSGPVKALAYLLTHGVLGFSMGSLW-RLGVDWGLSIFLCTIV 62
           GV    K +V++   L +   P K +  ++  G +G  MGS+W R+G +        T+V
Sbjct: 156 GVTIDEKKIVSSTGALALSEIPKKLV--VIGAGYIGLEMGSVWGRIGSE-------VTVV 206

Query: 63  VFAS 66
            FAS
Sbjct: 207 EFAS 210


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.335    0.145    0.457 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,700,001
Number of Sequences: 62578
Number of extensions: 126722
Number of successful extensions: 393
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 392
Number of HSP's gapped (non-prelim): 7
length of query: 147
length of database: 14,973,337
effective HSP length: 90
effective length of query: 57
effective length of database: 9,341,317
effective search space: 532455069
effective search space used: 532455069
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 47 (22.7 bits)