Query         032121
Match_columns 147
No_of_seqs    123 out of 184
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:52:36 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032121.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032121hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04755 PAP_fibrillin:  PAP_fi  99.8 1.8E-19 3.9E-24  141.1  10.3   93    3-105    43-137 (198)
  2 PF14869 DUF4488:  Domain of un  64.6      59  0.0013   25.3   7.9   59   10-89      3-63  (133)
  3 TIGR03067 Planc_TIGR03067 Plan  36.3      18 0.00038   26.4   0.9   18    6-23      3-20  (107)
  4 PF05015 Plasmid_killer:  Plasm  35.8      22 0.00048   25.1   1.3   13   10-22     69-81  (93)
  5 PF14155 DUF4307:  Domain of un  27.1      86  0.0019   23.1   3.3   18   80-97     38-55  (112)
  6 PF02630 SCO1-SenC:  SCO1/SenC;  27.0      30 0.00064   26.8   0.8   26    2-27     42-70  (174)
  7 cd01493 APPBP1_RUB Ubiquitin a  21.3 1.1E+02  0.0023   27.7   3.3   47  100-146   261-315 (425)
  8 COG1999 Uncharacterized protei  19.5      66  0.0014   25.9   1.5   23    2-24     57-82  (207)
  9 cd04755 Commd7 COMM_Domain con  18.4 1.4E+02  0.0031   24.1   3.2   47    9-67    116-163 (180)
 10 COG3041 Uncharacterized protei  17.1      85  0.0018   23.0   1.5   12   10-21     62-73  (91)

No 1  
>PF04755 PAP_fibrillin:  PAP_fibrillin;  InterPro: IPR006843 This family identifies a conserved domain found in a number of plastid lipid-associated proteins (PAPs) that are thought to form together with other plastoglobulins a coat on the surface of the lipoprotein particle. The coat may contain receptors for attachment to the thylakoid membrane as well as regulatory proteins that may function in the transfer of lipids to and from the thylakoid membranes.). This entry also represents a number of putative fibrillin proteins.; GO: 0005198 structural molecule activity, 0009507 chloroplast
Probab=99.81  E-value=1.8e-19  Score=141.10  Aligned_cols=93  Identities=38%  Similarity=0.673  Sum_probs=80.8

Q ss_pred             CCCCc-cCCCceEEEEEecchhhHHHHHhhccCCceeeeeeeEEEeeecCCCCceEEEEEEecC-CccccccCceeEEEE
Q 032121            3 EPIDL-VKLDGTWRLQYTSAPDVLVLFEAAARLPFFKVGQIFQKFECRDKSDGGVICNVVRWSV-PPLLEKEEGATLVVS   80 (147)
Q Consensus         3 ~~l~~-~lL~G~WrLlYTTa~ell~ll~a~~~lP~v~vG~IyQ~ID~~~~~~~~~v~Nvv~~~~-P~~~~~~~G~~l~V~   80 (147)
                      +|++. ++|+|+|+|+|||+.+..+.++. +++|++++|+|||+||    .+++++.|+++|.. |..    +| .+.|+
T Consensus        43 ~p~~s~~~L~G~W~Lvytt~~~~~~~l~~-~~~~~~~~~~v~Q~id----~~~~~~~N~v~~~~~~~~----~~-~~~v~  112 (198)
T PF04755_consen   43 DPADSLPLLDGRWELVYTTSPEIRSLLQR-GRLPGVRVGRVFQTID----ADNGRVENVVELSGFPLL----EG-SVSVR  112 (198)
T ss_pred             CCcCCchhcCcEEEEEeecCCCccccccc-cccccccccceEEEEE----CCCceEEEEEEEeccCce----EE-EEEEE
Confidence            45666 89999999999999999987764 6778899999999999    55889999999875 543    34 89999


Q ss_pred             EEEEEcCCceEEEEEEEEEEecccc
Q 032121           81 AKFDVVSVRNIYLQFEEVTVQNIYI  105 (147)
Q Consensus        81 A~fev~s~~RV~v~Fe~~~v~~~~i  105 (147)
                      |++++.+++|+.++|+++.++...+
T Consensus       113 a~~~~~~~~rv~v~f~~~~l~~~~~  137 (198)
T PF04755_consen  113 ASLEVRSPRRVEVTFERASLKPPSL  137 (198)
T ss_pred             EEEEEccccEEEEEEEeeEEcccce
Confidence            9999999999999999999988776


No 2  
>PF14869 DUF4488:  Domain of unknown function (DUF4488)
Probab=64.57  E-value=59  Score=25.31  Aligned_cols=59  Identities=24%  Similarity=0.463  Sum_probs=40.7

Q ss_pred             CCceEEEE-EecchhhHHHHHhhccCCc-eeeeeeeEEEeeecCCCCceEEEEEEecCCccccccCceeEEEEEEEEEcC
Q 032121           10 LDGTWRLQ-YTSAPDVLVLFEAAARLPF-FKVGQIFQKFECRDKSDGGVICNVVRWSVPPLLEKEEGATLVVSAKFDVVS   87 (147)
Q Consensus        10 L~G~WrLl-YTTa~ell~ll~a~~~lP~-v~vG~IyQ~ID~~~~~~~~~v~Nvv~~~~P~~~~~~~G~~l~V~A~fev~s   87 (147)
                      |.|-|++. |-+..         ...|+ ++.+.++-.+.     +++++.|+.-..  .     .|+.++...+|+..|
T Consensus         3 l~GVWQ~c~~~~~~---------~~~~g~l~~~~~lKilS-----~Dgtf~Ni~~~~--~-----~~aiIt~~GtY~~~s   61 (133)
T PF14869_consen    3 LQGVWQLCHYVSES---------PEVPGKLKPSNVLKILS-----DDGTFVNITMIP--K-----SGAIITGYGTYEQPS   61 (133)
T ss_pred             ceEEEEEEEEeecC---------cccCceEeecccEEEEc-----CCCcEEEEEEeC--C-----CCcEEEEeEEEEEcC
Confidence            78999999 44433         12333 56677777554     588999988743  2     346788888999988


Q ss_pred             Cc
Q 032121           88 VR   89 (147)
Q Consensus        88 ~~   89 (147)
                      +.
T Consensus        62 D~   63 (133)
T PF14869_consen   62 DN   63 (133)
T ss_pred             Cc
Confidence            76


No 3  
>TIGR03067 Planc_TIGR03067 Planctomycetes uncharacterized domain TIGR03067. This domain occurs in several species, mostly from the Planctomycetes division of the bacteria. It is expanded into a paralogous family of at least twenty-five members in Gemmata obscuriglobus UQM 2246. This family appears related to TIGR03066, which also is expanded into a large paralogous family in Gemmata obscuriglobus.
Probab=36.25  E-value=18  Score=26.44  Aligned_cols=18  Identities=39%  Similarity=0.702  Sum_probs=15.2

Q ss_pred             CccCCCceEEEEEecchh
Q 032121            6 DLVKLDGTWRLQYTSAPD   23 (147)
Q Consensus         6 ~~~lL~G~WrLlYTTa~e   23 (147)
                      |++.|+|+|+++......
T Consensus         3 dl~~LqG~W~~v~~e~~G   20 (107)
T TIGR03067         3 DLEKLQGTWKVVAAEKGG   20 (107)
T ss_pred             hHHhhCcEEEEEEEEeCC
Confidence            678999999999877753


No 4  
>PF05015 Plasmid_killer:  Plasmid maintenance system killer protein;  InterPro: IPR007711 Several plasmids with proteic killer gene systems have been reported. All of them encode a stable toxin and an unstable antidote. Upon loss of the plasmid, the less stable inhibitor is inactivated more rapidly than the toxin, allowing the toxin to be activated. The activation of those systems result in cell filamentation and cessation of viable cell production. It has been verified that both the stable killer and the unstable inhibitor of the systems are short polypeptides. This family corresponds to the toxin.
Probab=35.83  E-value=22  Score=25.09  Aligned_cols=13  Identities=31%  Similarity=0.884  Sum_probs=10.1

Q ss_pred             CCceEEEEEecch
Q 032121           10 LDGTWRLQYTSAP   22 (147)
Q Consensus        10 L~G~WrLlYTTa~   22 (147)
                      ++|+|||+|.-..
T Consensus        69 i~~~~RliF~~~~   81 (93)
T PF05015_consen   69 INGNWRLIFRFED   81 (93)
T ss_pred             eCCCEEEEEEEeC
Confidence            6789999987543


No 5  
>PF14155 DUF4307:  Domain of unknown function (DUF4307)
Probab=27.08  E-value=86  Score=23.05  Aligned_cols=18  Identities=22%  Similarity=0.399  Sum_probs=14.0

Q ss_pred             EEEEEEcCCceEEEEEEE
Q 032121           80 SAKFDVVSVRNIYLQFEE   97 (147)
Q Consensus        80 ~A~fev~s~~RV~v~Fe~   97 (147)
                      ...|++.++.+++|+|+=
T Consensus        38 ~~gf~vv~d~~v~v~f~V   55 (112)
T PF14155_consen   38 VIGFEVVDDSTVEVTFDV   55 (112)
T ss_pred             EEEEEECCCCEEEEEEEE
Confidence            467888888888888863


No 6  
>PF02630 SCO1-SenC:  SCO1/SenC;  InterPro: IPR003782 This family is involved in biogenesis of respiratory and photosynthetic systems. In yeast the SCO1 protein is specifically required for a post-translational step in the accumulation of subunits 1 and 2 of cytochrome c oxidase (COXI and COX-II) []. It is a mitochondrion-associated cytochrome c oxidase assembly factor. The purple nonsulphur photosynthetic eubacterium Rhodobacter capsulatus is a versatile organism that can obtain cellular energy by several means, including the capture of light energy for photosynthesis as well as the use of light-independent respiration, in which molecular oxygen serves as a terminal electron acceptor. The SenC protein is required for optimal cytochrome c oxidase activity in aerobically grown R. capsulatus cells and is involved in the induction of structural polypeptides of the light-harvesting and reaction centre complexes [].; PDB: 2K6V_A 3ME8_A 3ME7_A 2GT6_A 2GQL_A 2GQK_A 2GGT_B 1WP0_C 2HRN_A 2GQM_A ....
Probab=26.98  E-value=30  Score=26.79  Aligned_cols=26  Identities=42%  Similarity=0.772  Sum_probs=19.4

Q ss_pred             CCCCCccCCCceEEEE---EecchhhHHH
Q 032121            2 GEPIDLVKLDGTWRLQ---YTSAPDVLVL   27 (147)
Q Consensus         2 ~~~l~~~lL~G~WrLl---YTTa~ell~l   27 (147)
                      |.+.+++.+.|+|.|+   ||+=+++=+.
T Consensus        42 G~~~~~~~~~Gk~~lv~F~yT~CpdvCp~   70 (174)
T PF02630_consen   42 GKTVTLDDLKGKWVLVFFGYTRCPDVCPT   70 (174)
T ss_dssp             SSEEEGGGGTTSEEEEEEE-TTSSSHHHH
T ss_pred             CCEecHHHhCCCeEEEEEEEcCCCccCHH
Confidence            6778889999999987   4566665444


No 7  
>cd01493 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APPBP1. APPBP1 is part of the heterodimeric activating enzyme (E1), specific for the Rub family of ubiquitin-like proteins (Ubls). E1 enzymes are part of a conjugation cascade to attach Ub or Ubls, covalently to substrate proteins consisting of activating (E1), conjugating (E2), and/or ligating (E3) enzymes. E1 activates ubiquitin(-like) by C-terminal adenylation, and subsequently forms a highly reactive thioester bond between its catalytic cysteine and Ubls C-terminus. E1 also associates with E2 and promotes ubiquitin transfer to the E2's catalytic cysteine. Post-translational modification by Rub family of ubiquitin-like proteins (Ublps) activates SCF ubiquitin ligases and is involved in cell cycle control, signaling and embryogenesis. ABPP1 contains part of the adenylation domain.
Probab=21.29  E-value=1.1e+02  Score=27.71  Aligned_cols=47  Identities=13%  Similarity=0.289  Sum_probs=30.1

Q ss_pred             EecccccHHHHHhhcc----ccCCcchhhHHHHHHHhhc----cccceecCCCCC
Q 032121          100 VQNIYISEELQALIAP----AILPRSFLSLQILQFIRAF----KAQIPVTNTTPG  146 (147)
Q Consensus       100 v~~~~is~~le~l~a~----~~lpr~~l~~q~l~~~~~~----~~~~p~~~~~~~  146 (147)
                      +.+..|++++++++--    -+.+.+.-=.-++.|||+|    ....||.|.+|-
T Consensus       261 ~~~~~i~~~v~~~~~~~~~~~~~~~~~~fwi~~~alk~F~~~~~g~lPl~G~lPD  315 (425)
T cd01493         261 LNRTKIPSSVEEIFNDDRCENLTSQSSSFWIMARALKEFVAEENGLLPLPGTLPD  315 (425)
T ss_pred             hCCCCCcHHHHHHHhchhcccCCCCCchHHHHHHHHHHHHHhcCCCCCCCCCCCC
Confidence            5566788888887621    1222222222378899999    345999999983


No 8  
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]
Probab=19.48  E-value=66  Score=25.88  Aligned_cols=23  Identities=43%  Similarity=0.743  Sum_probs=19.1

Q ss_pred             CCCCCccCCCceEEEEE---ecchhh
Q 032121            2 GEPIDLVKLDGTWRLQY---TSAPDV   24 (147)
Q Consensus         2 ~~~l~~~lL~G~WrLlY---TTa~el   24 (147)
                      |++.++..|.|+|.|+|   |+=+++
T Consensus        57 G~~~~~~~l~Gk~~lv~FgyT~CpdV   82 (207)
T COG1999          57 GKPFTLKDLKGKPSLVFFGYTHCPDV   82 (207)
T ss_pred             CCEeeccccCCCEEEEEeecCCCCcc
Confidence            78889999999999985   666664


No 9  
>cd04755 Commd7 COMM_Domain containing protein 7. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=18.38  E-value=1.4e+02  Score=24.08  Aligned_cols=47  Identities=19%  Similarity=0.358  Sum_probs=30.0

Q ss_pred             CCCceEEEEEecchhhHHHHHhhccCCceeeeeeeEEEeeecCCCCceEEEE-EEecCCc
Q 032121            9 KLDGTWRLQYTSAPDVLVLFEAAARLPFFKVGQIFQKFECRDKSDGGVICNV-VRWSVPP   67 (147)
Q Consensus         9 lL~G~WrLlYTTa~ell~ll~a~~~lP~v~vG~IyQ~ID~~~~~~~~~v~Nv-v~~~~P~   67 (147)
                      +.|=.||+=||.+++...=+    +-|+++++=..   |     +++..+++ .+++.|-
T Consensus       116 L~d~~Wr~~~~~sSS~~~~~----~~p~vqLkl~~---~-----~~~~~e~v~~E~t~~q  163 (180)
T cd04755         116 LVDMEWKFGVTAGSSELQKV----GSIFLQLKLVV---R-----KGNQTENVYMELTLPQ  163 (180)
T ss_pred             cccccceeeeEecchhhhhc----CCcEEEEEEEe---c-----CCCCceeEEEEEcHHH
Confidence            44557999999999765443    33888866533   2     24445676 5676553


No 10 
>COG3041 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=17.11  E-value=85  Score=23.00  Aligned_cols=12  Identities=25%  Similarity=0.274  Sum_probs=9.9

Q ss_pred             CCceEEEEEecc
Q 032121           10 LDGTWRLQYTSA   21 (147)
Q Consensus        10 L~G~WrLlYTTa   21 (147)
                      +.+.|.|+||=.
T Consensus        62 i~pD~lLIY~v~   73 (91)
T COG3041          62 IKPDLLLIYTVK   73 (91)
T ss_pred             cCCCEEEEEEEe
Confidence            467899999977


Done!