Query         032127
Match_columns 147
No_of_seqs    137 out of 187
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:57:23 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032127.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032127hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00042 photosystem II oxygen 100.0 4.6E-34   1E-38  238.5   7.1  116   28-146    27-154 (260)
  2 PLN00059 PsbP domain-containin  99.9 7.8E-26 1.7E-30  190.0   7.9  104   40-147    65-174 (286)
  3 PF01789 PsbP:  PsbP;  InterPro  99.8   8E-22 1.7E-26  154.1   3.4   80   68-147     6-86  (175)
  4 PLN00067 PsbP domain-containin  99.7 2.8E-18 6.2E-23  143.8   6.7   95   51-147    40-178 (263)
  5 PLN00066 PsbP domain-containin  99.6 2.8E-15 6.1E-20  126.1   7.2   97   51-147    42-180 (262)
  6 PLN03152 hypothetical protein;  98.5 9.7E-08 2.1E-12   79.4   4.1   59   88-147    79-162 (241)
  7 PF12712 DUF3805:  Domain of un  88.3    0.58 1.3E-05   37.0   3.4   45   86-131     2-47  (153)
  8 PF10518 TAT_signal:  TAT (twin  72.4       3 6.6E-05   23.5   1.7   13   54-66      2-14  (26)
  9 PLN02729 PSII-Q subunit         66.4       4 8.7E-05   34.2   1.9   29   52-80     48-76  (220)
 10 TIGR02811 formate_TAT formate   65.3     9.3  0.0002   26.1   3.2   13   51-63      6-18  (66)
 11 PF07174 FAP:  Fibronectin-atta  52.7     8.3 0.00018   33.6   1.6   21   87-107   111-131 (297)
 12 PF05757 PsbQ:  Oxygen evolving  49.5     5.8 0.00013   32.7   0.1   21   40-61     16-36  (202)
 13 PRK10882 hydrogenase 2 protein  39.9      34 0.00073   29.9   3.4    9   55-63      2-10  (328)
 14 PF10399 UCR_Fe-S_N:  Ubiquitin  37.3      32  0.0007   21.4   2.1   12   50-61      5-16  (41)
 15 PF12318 FAD-SLDH:  Membrane bo  35.2      25 0.00053   27.8   1.6    7   54-60      2-8   (168)
 16 PRK05363 TMAO/DMSO reductase;   33.3      71  0.0015   28.1   4.3   10   53-62     20-29  (319)
 17 PF12559 Inhibitor_I10:  Serine  28.7      22 0.00047   23.9   0.3   12   94-105    44-55  (56)
 18 COG4784 Putative Zn-dependent   27.9      43 0.00092   30.6   2.1   30   75-104   274-306 (479)
 19 PF08786 DUF1795:  Domain of un  25.3      61  0.0013   23.5   2.2   43   96-140     3-46  (130)
 20 TIGR01409 TAT_signal_seq Tat (  24.5      53  0.0011   18.5   1.4   12   54-65      1-12  (29)
 21 PF08006 DUF1700:  Protein of u  24.1      15 0.00032   28.6  -1.3   14  134-147    44-57  (181)
 22 PF10633 NPCBM_assoc:  NPCBM-as  23.7      85  0.0018   20.8   2.5   36   93-132    24-61  (78)
 23 PRK10123 wcaM putative colanic  23.7 1.4E+02   0.003   26.9   4.5   25  121-145   111-139 (464)
 24 PRK07474 sulfur oxidation prot  22.6      67  0.0015   25.4   2.1    9   53-61      7-15  (154)
 25 PF05984 Cytomega_UL20A:  Cytom  21.8      59  0.0013   23.9   1.5   16   55-70      2-17  (100)
 26 TIGR02543 List_Bact_rpt Lister  21.5      96  0.0021   19.2   2.3   34   91-127     2-36  (44)
 27 PLN00058 photosystem II reacti  20.6      84  0.0018   23.5   2.1   15   51-65     46-60  (103)

No 1  
>PLN00042 photosystem II oxygen-evolving enhancer protein 2; Provisional
Probab=100.00  E-value=4.6e-34  Score=238.47  Aligned_cols=116  Identities=33%  Similarity=0.549  Sum_probs=99.3

Q ss_pred             ccccccCCccceeeccCccccccchhhhHHHHHH---HHHHHhhhhCCCccccccc-----ccCCcccceeC-CCCeEEe
Q 032127           28 TRSATAFSCQNFFTCPEDISSDEENKSKRRLLLM---GAGLLTANLLPANSLFAQE-----IPKNYDAFVDR-IDGYSYV   98 (147)
Q Consensus        28 ~r~~~~~~~~~~~~c~~~~~~~~~~~~~RR~aL~---g~aa~~a~~~pa~aA~ae~-----~p~g~~~f~d~-~dGysfl   98 (147)
                      +|.....++++ ++|++|++  ..+.++||.+|+   |++++++.+.|+++||||+     +|++.++|+++ +|||+|+
T Consensus        27 ~~~~~~~~~~~-~~~~~~~~--~~~~~srr~~l~~~~ga~a~~~~~~pa~aay~~~anvfg~~k~~~gF~~y~~dgY~Fl  103 (260)
T PLN00042         27 ARAVSASRPSQ-VVCRAQEE--DNSAVSRRAALALLAGAAAAGAKVSPANAAYGESANVFGKPKTNTGFLPYNGDGFKLL  103 (260)
T ss_pred             ccccCCCCCcc-eeeecccc--ccccccHHHHHHHHHHHHHhhcccCchhhhhcchhhccCCCCCCCCCeEeeCCCeEEe
Confidence            34444555555 69999876  446689998877   4455678999999999999     88888888888 5999999


Q ss_pred             ccCCce---EeeecCCcceecCcccCccceEEEEecCCCCCcccCCCcccc
Q 032127           99 YPSDWT---EFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEF  146 (147)
Q Consensus        99 yPs~W~---ev~~~G~d~~f~D~~~~~eNVsV~Vsp~~~~sI~dfGsPeev  146 (147)
                      ||++|+   |++++|+|++|||+|+++|||+|+|+|++|++|+|||+||||
T Consensus       104 yP~~W~~~ke~~~~G~dv~f~D~~~~~eNVSV~Ispt~k~sI~dlGsPee~  154 (260)
T PLN00042        104 VPSKWNPSKEREFPGQVLRFEDNFDATSNLSVMVTPTDKKSITDYGSPEEF  154 (260)
T ss_pred             cCCCCccccccccCCceEEeeccccccccEEEEEecCCcCCHhhcCCHHHH
Confidence            999995   778899999999999999999999999999999999999996


No 2  
>PLN00059 PsbP domain-containing protein 1; Provisional
Probab=99.92  E-value=7.8e-26  Score=190.01  Aligned_cols=104  Identities=28%  Similarity=0.462  Sum_probs=82.2

Q ss_pred             eeccCccccccchhhhHHHHHH-HH--HHHhhhhCCCcccccccccCCcccceeCCCCeEEeccCCceEeeecCCcceec
Q 032127           40 FTCPEDISSDEENKSKRRLLLM-GA--GLLTANLLPANSLFAQEIPKNYDAFVDRIDGYSYVYPSDWTEFEFTGHDSGFK  116 (147)
Q Consensus        40 ~~c~~~~~~~~~~~~~RR~aL~-g~--aa~~a~~~pa~aA~ae~~p~g~~~f~d~~dGysflyPs~W~ev~~~G~d~~f~  116 (147)
                      +.|..+.+  ..-+++||++|+ +.  +.+.....-...|+|+  |+||+.|+|..|||+|+||.||++|...|+|++||
T Consensus        65 ~~~~~~~~--~~~~~~rr~~~~~~l~~~~~~~s~~~~~~a~a~--~~~l~~y~D~~DGY~FlYP~GWi~V~~~G~DVvFr  140 (286)
T PLN00059         65 INCLTDAK--QVCAVGRRKSMMMGLLMSGLIVSEANLPTAFAS--IPVFREYIDTFDGYSFKYPQNWIQVRGAGADIFFR  140 (286)
T ss_pred             eecccchh--hhhhhhhhhhhHHHHHHHHHHHHhhcCchhhcC--CcccceeEcCCCCeEEeCCCCCeEeccCCCceEEe
Confidence            35664442  344789999975 22  1122222223356764  66899999999999999999999999999999999


Q ss_pred             CcccCccceEEEEecCC---CCCcccCCCccccC
Q 032127          117 DRYLQLQNVRVRFIPTD---KKDVHDLGPMEEFL  147 (147)
Q Consensus       117 D~~~~~eNVsV~Vsp~~---~~sI~dfGsPeeva  147 (147)
                      |+++.+|||||+|+|++   +++|+|||+|+||+
T Consensus       141 D~Ie~~ENVSV~ISs~sss~~~sLeDLGsP~eVg  174 (286)
T PLN00059        141 DPVVLDENLSVEFSSPSSSKYTSLEDLGSPEEVG  174 (286)
T ss_pred             ccCccccceEEEEecCCcccCCChHHcCCHHHHH
Confidence            99999999999999764   89999999999984


No 3  
>PF01789 PsbP:  PsbP;  InterPro: IPR002683 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbP. Both PsbP and PsbQ (IPR008797 from INTERPRO) are regulators that are necessary for the biogenesis of optically active PSII. PsbP increases the affinity of the water oxidation site for chloride ions and provides the conditions required for high affinity binding of calcium ions [, ]. The crystal structure of PsbP from Nicotiana tabacum (Common tobacco) revealed a two-domain structure, where domain 1 may play a role in the ion retention activity in PSII, the N-terminal residues being essential for calcium and chloride ion retention activity []. PsbP is encoded in the nuclear genome in plants.; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 2VU4_A 1V2B_A 2LNJ_A 2XB3_A.
Probab=99.84  E-value=8e-22  Score=154.11  Aligned_cols=80  Identities=38%  Similarity=0.596  Sum_probs=62.3

Q ss_pred             hhhCCCcccccccccCCcccceeCCCCeEEeccCCceEeeecCCcceecCcccCccceEEEEecCCCC-CcccCCCcccc
Q 032127           68 ANLLPANSLFAQEIPKNYDAFVDRIDGYSYVYPSDWTEFEFTGHDSGFKDRYLQLQNVRVRFIPTDKK-DVHDLGPMEEF  146 (147)
Q Consensus        68 a~~~pa~aA~ae~~p~g~~~f~d~~dGysflyPs~W~ev~~~G~d~~f~D~~~~~eNVsV~Vsp~~~~-sI~dfGsPeev  146 (147)
                      +.+.++..+.++..++||+.|.|..+||+|+||++|+++++.|++++|+|+++.++||+|+|+|+.+. +|+|||+|+||
T Consensus         6 ~~~~~~~~~~~~~~~~~~~~y~d~~~~y~f~~P~gW~~~~~~G~~v~f~d~~~~~~nvsV~v~p~~~~~sl~~lGs~~~v   85 (175)
T PF01789_consen    6 ALLSSANVACAAEASTGFQPYTDSDDGYSFLYPSGWEEVDVSGADVVFRDPIDADENVSVVVSPVPKDFSLEDLGSPEEV   85 (175)
T ss_dssp             ----------STT--SSEEEEEECTTTEEEEEETTEEEEESTTEEEEEEETTETTSEEEEEEEE-STS-SGGGG-SHHHH
T ss_pred             EeeccchhhhcccCCCCceEEEcCCCCEEEECCCCCeecCCCCeEEEEECcccccceEEEEEEecCCcCchhhcCCHHHH
Confidence            33344555555667889999999999999999999999999999999999999999999999999755 99999999997


Q ss_pred             C
Q 032127          147 L  147 (147)
Q Consensus       147 a  147 (147)
                      +
T Consensus        86 a   86 (175)
T PF01789_consen   86 A   86 (175)
T ss_dssp             H
T ss_pred             H
Confidence            4


No 4  
>PLN00067 PsbP domain-containing protein 6; Provisional
Probab=99.74  E-value=2.8e-18  Score=143.82  Aligned_cols=95  Identities=23%  Similarity=0.451  Sum_probs=67.2

Q ss_pred             chhhhHHHHHHHHHHHhhh-hCCCccccccc---------ccC--CcccceeC-----------CCCeEEeccCCceEee
Q 032127           51 ENKSKRRLLLMGAGLLTAN-LLPANSLFAQE---------IPK--NYDAFVDR-----------IDGYSYVYPSDWTEFE  107 (147)
Q Consensus        51 ~~~~~RR~aL~g~aa~~a~-~~pa~aA~ae~---------~p~--g~~~f~d~-----------~dGysflyPs~W~ev~  107 (147)
                      ...+.||+.|.|+++.... .....++.|-+         .|.  ||-.|...           -.||+|+||.+|+++.
T Consensus        40 ~~~~~rr~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~lp~~~~~~~~~~f~~~~~~tpalra~~i~gY~FlyP~gW~~v~  119 (263)
T PLN00067         40 AVVIHRRELLLGLALAPLILIAPEPPAEAREVEVGSYLPPSPSDPSFVLFKASPKDTPALRAGNVQPYQFILPPTWKQTR  119 (263)
T ss_pred             cchhHHHHHHhhhhhhhhhhccCCchhhhheehhhcccCCCCCCCceEEEecCCCCCcccccCCcccceEeCCCCCcCcc
Confidence            3457899999877654221 12222333322         222  45555432           3699999999999888


Q ss_pred             ec----C-----------CcceecCcccCccceEEEEecC------CCCCcccCCCccccC
Q 032127          108 FT----G-----------HDSGFKDRYLQLQNVRVRFIPT------DKKDVHDLGPMEEFL  147 (147)
Q Consensus       108 ~~----G-----------~d~~f~D~~~~~eNVsV~Vsp~------~~~sI~dfGsPeeva  147 (147)
                      +.    |           +|++|+|++  ++||+|+|+|+      ++++|+|||+||||+
T Consensus       120 Vs~~~sGnycqp~c~~p~~dv~F~D~~--dgnVSVIVSPV~r~t~k~~~sIeDlGsPeeVl  178 (263)
T PLN00067        120 VANILSGNYCQPKCAEPWVEVKFEDEK--QGKVQVVASPLIRLTNKPNATIEEIGSPEKLI  178 (263)
T ss_pred             ccccccCccccccccCCCceEEEeCCC--CCCEEEEEecccccccCCCCChHHccCHHHHH
Confidence            75    4           899999955  77999999997      568999999999984


No 5  
>PLN00066 PsbP domain-containing protein 4; Provisional
Probab=99.58  E-value=2.8e-15  Score=126.06  Aligned_cols=97  Identities=18%  Similarity=0.350  Sum_probs=67.6

Q ss_pred             chhhhHHHHHHHHHHH---hhhhCCCc--cc-cccc----------ccCCcccceeC-------------CCCeEEeccC
Q 032127           51 ENKSKRRLLLMGAGLL---TANLLPAN--SL-FAQE----------IPKNYDAFVDR-------------IDGYSYVYPS  101 (147)
Q Consensus        51 ~~~~~RR~aL~g~aa~---~a~~~pa~--aA-~ae~----------~p~g~~~f~d~-------------~dGysflyPs  101 (147)
                      ...++||.+|+..+++   ++...|+.  |+ +|-.          --.|++.|.-+             ...|+|+||.
T Consensus        42 ~~~~~rr~~~~s~~~~~~~~~~~~~~~~~a~~~g~~ag~~~~~s~~~~~g~~~~~rp~~~~Gg~G~~~~~i~~Y~F~yP~  121 (262)
T PLN00066         42 ATAVSRRSALASGAAAASSAVLAFPGEGLAVKQGLLAGRVPGLSEPDENGWRTYRRPEGKSGGHGVGWSEITPYSFKVPQ  121 (262)
T ss_pred             cchhhHHHHHHHHHHHHhhhhhcCCcchhhhhhcccccCCCCCCCccccceEEEecCccccCcCCCCccccCCeEEECCC
Confidence            3467999999844333   11223322  22 3311          12356666543             2569999999


Q ss_pred             CceEeeec-----CCcceecCcccCccceEEEEecC--------CCCCcccCCCccccC
Q 032127          102 DWTEFEFT-----GHDSGFKDRYLQLQNVRVRFIPT--------DKKDVHDLGPMEEFL  147 (147)
Q Consensus       102 ~W~ev~~~-----G~d~~f~D~~~~~eNVsV~Vsp~--------~~~sI~dfGsPeeva  147 (147)
                      +|+|+.+.     |.++.|++..+.++||+|+|+|+        ++++|+|||+||||+
T Consensus       122 GW~ev~VS~~d~gg~~vd~Rf~~~~~~nvsVvVspv~rla~~~~~~~sI~dLGspeeVi  180 (262)
T PLN00066        122 GWEEVPVSIADLGGTEIDLRFASDKEGRLKVVVAPVLRFADNLGDNATIEEIGPPEKVI  180 (262)
T ss_pred             CCeEeecccccCCCCceEEEeccCCCccEEEEEeccccccccccCCCChHHcCCHHHHH
Confidence            99999886     65566666668999999999997        689999999999974


No 6  
>PLN03152 hypothetical protein; Provisional
Probab=98.51  E-value=9.7e-08  Score=79.43  Aligned_cols=59  Identities=25%  Similarity=0.437  Sum_probs=43.5

Q ss_pred             ceeCCCCeEEeccCCceEe----eec-CC------------cceecCcccCccceEEEEecC--------CCCCcccCCC
Q 032127           88 FVDRIDGYSYVYPSDWTEF----EFT-GH------------DSGFKDRYLQLQNVRVRFIPT--------DKKDVHDLGP  142 (147)
Q Consensus        88 f~d~~dGysflyPs~W~ev----~~~-G~------------d~~f~D~~~~~eNVsV~Vsp~--------~~~sI~dfGs  142 (147)
                      |.=++|||+.-||-++..+    ++. |-            ..||- --|.+|||||+|+|+        +.++|+|||+
T Consensus        79 ~~~~g~gf~~~~pp~f~di~e~~~~~~g~~~yg~~akp~~~~aRf~-s~D~sEnVSVVIspv~~LK~tfle~kDLtDLGs  157 (241)
T PLN03152         79 FQFYGDGFSIRVPPSFEDIMEPEDYNAGLSLYGDKAKPRTFAARFA-SPDGSEVLSVVIRPSNQLKITFLEAKDITDLGS  157 (241)
T ss_pred             hhhhCCceEEeCCCChhhhcChhhcccccceecCCCCCcceeeeec-CCCCCceEEEEEecCccccccccccCChhHcCC
Confidence            3445899999999999433    222 21            12332 346899999999996        6899999999


Q ss_pred             ccccC
Q 032127          143 MEEFL  147 (147)
Q Consensus       143 Peeva  147 (147)
                      |+||+
T Consensus       158 p~EVg  162 (241)
T PLN03152        158 LKEAA  162 (241)
T ss_pred             HHHHH
Confidence            99985


No 7  
>PF12712 DUF3805:  Domain of unknown function (DUF3805);  InterPro: IPR024315 This entry represents an N-terminal domain found in a family of bacterial proteins, whose function is unknown. In two related Bacteroides species, the gene for members of this family lies immediately upstream from a putative ATP binding component of an ATP transporter and a putative histidinol phosphatase. The structure of this domain is strikingly similar to the N-terminal structure of 1tui, also of unknown function. The domain carries four conserved tryptophan residues.; PDB: 3HLZ_A.
Probab=88.28  E-value=0.58  Score=36.99  Aligned_cols=45  Identities=29%  Similarity=0.452  Sum_probs=26.7

Q ss_pred             ccceeCCCCeEEeccCCceEeeecCCc-ceecCcccCccceEEEEec
Q 032127           86 DAFVDRIDGYSYVYPSDWTEFEFTGHD-SGFKDRYLQLQNVRVRFIP  131 (147)
Q Consensus        86 ~~f~d~~dGysflyPs~W~ev~~~G~d-~~f~D~~~~~eNVsV~Vsp  131 (147)
                      +-|+.++.=|++.||.+|-|.+ +|.+ -.|.|+-.-+-|..+..-.
T Consensus         2 kKfiSpg~WFS~~YP~~W~EfE-D~E~sflFYnp~~WTGNfRISayk   47 (153)
T PF12712_consen    2 KKFISPGAWFSMEYPADWNEFE-DGEGSFLFYNPDQWTGNFRISAYK   47 (153)
T ss_dssp             EEEE-GGG-EEEEE-TT-EEE----TTEEEEE-SSS---EEEEEEEE
T ss_pred             CcccCCCceEEEecCCCcchhc-cCCcceEEEChHHhcCceEEEEEe
Confidence            4578888889999999999888 5554 5788888888888876553


No 8  
>PF10518 TAT_signal:  TAT (twin-arginine translocation) pathway signal sequence;  InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes []. Homologues of the genes that encode the transport apparatus occur in archaea, bacteria, chloroplasts, and plant mitochondria []. In bacteria, the Tat pathway catalyses the export of proteins from the cytoplasm across the inner/cytoplasmic membrane. In chloroplasts, the Tat components are found in the thylakoid membrane and direct the import of proteins from the stroma. The Tat pathway acts separately from the general secretory (Sec) pathway, which transports proteins in an unfolded state []. It is generally accepted that the primary role of the Tat system is to translocate fully folded proteins across membranes. An example of proteins that need to be exported in their 3D conformation are redox proteins that have acquired complex multi-atom cofactors in the bacterial cytoplasm (or the chloroplast stroma or mitochondrial matrix). They include hydrogenases, formate dehydrogenases, nitrate reductases, trimethylamine N-oxide (TMAO) reductases and dimethyl sulphoxide (DMSO) reductases [, ]. The Tat system can also export whole heteroligomeric complexes in which some proteins have no Tat signal. This is the case of the DMSO reductase or formate dehydrogenase complexes. But there are also other cases where the physiological rationale for targeting a protein to the Tat signal is less obvious. Indeed, there are examples of homologous proteins that are in some cases targeted to the Tat pathway and in other cases to the Sec apparatus. Some examples are: copper nitrite reductases, flavin domains of flavocytochrome c and N-acetylmuramoyl-L-alanine amidases []. In halophilic archaea such as Halobacterium almost all secreted proteins appear to be Tat targeted. It has been proposed to be a response to the difficulties these organisms would otherwise face in successfully folding proteins extracellularly at high ionic strength []. The Tat signal peptide consists of three motifs: the positively charged N-terminal motif, the hydrophobic region and the C-terminal region that generally ends with a consensus short motif (A-x-A) specifying cleavage by signal peptidase. Sequence analysis revealed that signal peptides capable of targeting the Tat protein contain the consensus sequence [ST]-R-R-x-F-L-K. The nearly invariant twin-arginine gave rise to the pathway's name. In addition the h-region of Tat signal peptides is typically less hydrophobic than that of Sec-specific signal peptides [, ]. 
Probab=72.39  E-value=3  Score=23.49  Aligned_cols=13  Identities=31%  Similarity=0.401  Sum_probs=9.7

Q ss_pred             hhHHHHHHHHHHH
Q 032127           54 SKRRLLLMGAGLL   66 (147)
Q Consensus        54 ~~RR~aL~g~aa~   66 (147)
                      .+||+.|.+.+++
T Consensus         2 ~sRR~fLk~~~a~   14 (26)
T PF10518_consen    2 LSRRQFLKGGAAA   14 (26)
T ss_pred             CcHHHHHHHHHHH
Confidence            5799999855544


No 9  
>PLN02729 PSII-Q subunit
Probab=66.40  E-value=4  Score=34.18  Aligned_cols=29  Identities=21%  Similarity=0.118  Sum_probs=16.3

Q ss_pred             hhhhHHHHHHHHHHHhhhhCCCccccccc
Q 032127           52 NKSKRRLLLMGAGLLTANLLPANSLFAQE   80 (147)
Q Consensus        52 ~~~~RR~aL~g~aa~~a~~~pa~aA~ae~   80 (147)
                      -..+||.+|.-+++..++-+.+.+++||.
T Consensus        48 ~~~~rr~~lgl~a~~l~~~s~~~~~~A~~   76 (220)
T PLN02729         48 FQTTRRLALGLASIALIGNSGNGVSLAED   76 (220)
T ss_pred             hhhhHHHHHHHHHHHHhcchhhhHHHhcc
Confidence            36789999853322222223356677765


No 10 
>TIGR02811 formate_TAT formate dehydrogenase region TAT target. Members of this uncharacterized protein family are all small, extending 70 or fewer residues from their respective likely start codons. All have the twin-arginine-dependent tranport (TAT) signal sequence at the N-terminus and a conserved 20-residue C-terminal region that includes the motif Y-[HRK]-X-[TS]-X-H-[IV]-X-X-[YF]-Y. The TAT signal sequence suggests a bound cofactor. All members are encoded near genes for subunits of formate dehydrogenase, and may themselves be a subunit or accessory protein.
Probab=65.25  E-value=9.3  Score=26.07  Aligned_cols=13  Identities=38%  Similarity=0.496  Sum_probs=9.4

Q ss_pred             chhhhHHHHHHHH
Q 032127           51 ENKSKRRLLLMGA   63 (147)
Q Consensus        51 ~~~~~RR~aL~g~   63 (147)
                      +..++||..|.++
T Consensus         6 ~~~~sRR~Flk~l   18 (66)
T TIGR02811         6 KADPSRRDLLKGL   18 (66)
T ss_pred             cCCccHHHHHHHH
Confidence            4457899998843


No 11 
>PF07174 FAP:  Fibronectin-attachment protein (FAP);  InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=52.68  E-value=8.3  Score=33.57  Aligned_cols=21  Identities=33%  Similarity=0.762  Sum_probs=16.8

Q ss_pred             cceeCCCCeEEeccCCceEee
Q 032127           87 AFVDRIDGYSYVYPSDWTEFE  107 (147)
Q Consensus        87 ~f~d~~dGysflyPs~W~ev~  107 (147)
                      ++.+...||+|++|.+|++-+
T Consensus       111 rvdn~~gGFS~vvP~GW~~Sd  131 (297)
T PF07174_consen  111 RVDNAAGGFSYVVPAGWVESD  131 (297)
T ss_pred             cccccccceEEeccCCccccc
Confidence            566667999999999996443


No 12 
>PF05757 PsbQ:  Oxygen evolving enhancer protein 3 (PsbQ);  InterPro: IPR008797 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbQ. Both PsbQ and PsbP (IPR002683 from INTERPRO) are regulators that are necessary for the biogenesis of optically active PSII. The crystal structure of PsbQ from spinach revealed a 4-helical bundle polypeptide. The distribution of positive and negative charges on the protein surface might explain the ability of PsbQ to increase the binding of chloride and calcium ions and make them available to PSII [].; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 1VYK_A 1NZE_A 3LS1_A 3LS0_A.
Probab=49.53  E-value=5.8  Score=32.67  Aligned_cols=21  Identities=19%  Similarity=0.245  Sum_probs=0.0

Q ss_pred             eeccCccccccchhhhHHHHHH
Q 032127           40 FTCPEDISSDEENKSKRRLLLM   61 (147)
Q Consensus        40 ~~c~~~~~~~~~~~~~RR~aL~   61 (147)
                      +.|+++.+ ..+...+||.+|.
T Consensus        16 ~~vra~~~-~~~~~~~RRa~l~   36 (202)
T PF05757_consen   16 VVVRASQS-PAQQQTSRRAVLG   36 (202)
T ss_dssp             ----------------------
T ss_pred             ceeccccC-cccccccHHHHHH
Confidence            35777652 2345678999975


No 13 
>PRK10882 hydrogenase 2 protein HybA; Provisional
Probab=39.89  E-value=34  Score=29.94  Aligned_cols=9  Identities=44%  Similarity=0.545  Sum_probs=6.8

Q ss_pred             hHHHHHHHH
Q 032127           55 KRRLLLMGA   63 (147)
Q Consensus        55 ~RR~aL~g~   63 (147)
                      +||..|.++
T Consensus         2 ~RR~fl~~~   10 (328)
T PRK10882          2 NRRNFLKAA   10 (328)
T ss_pred             CHHHHHHHH
Confidence            599999743


No 14 
>PF10399 UCR_Fe-S_N:  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal;  InterPro: IPR019470  This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex). This enzymex is an oligomeric membrane protein complex that is a component of respiratory and photosynthetic electron transfer chains. It couples the transfer of electrons from ubiquinol to cytochrome c with the generation of a protein gradient across the membrane []. This entry is associated with IPR017941 from INTERPRO, IPR004192 from INTERPRO and IPR015248 from INTERPRO. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0055114 oxidation-reduction process; PDB: 1ZRT_R 2QJY_R 2FYN_L 2QJK_O 2QJP_I 2YIU_F.
Probab=37.31  E-value=32  Score=21.44  Aligned_cols=12  Identities=33%  Similarity=0.354  Sum_probs=5.9

Q ss_pred             cchhhhHHHHHH
Q 032127           50 EENKSKRRLLLM   61 (147)
Q Consensus        50 ~~~~~~RR~aL~   61 (147)
                      +....+||..|.
T Consensus         5 ~~~~~~RRdFL~   16 (41)
T PF10399_consen    5 EPVDPTRRDFLT   16 (41)
T ss_dssp             -----HHHHHHH
T ss_pred             CCCCchHHHHHH
Confidence            345678999885


No 15 
>PF12318 FAD-SLDH:  Membrane bound FAD containing D-sorbitol dehydrogenase ;  InterPro: IPR024651 There are two types of membrane-bound D-sorbitol dehydrogenase: PQQ-SLDH (pyrroloquinoline quinone sorbitol dehydrogenase) and FAD-SLDH (FAD-containing sorbitol dehydrogenase). FAD-SLDH is involved in oxidation of D-sorbitol to L-sorbose and consists of a large, small and cytochrome c subunits []. This entry represents the small subunit of the FAD-containing D-sorbitol dehydrogenase. This family of proteins is found in bacteria and contains a conserved ALM sequence motif. The role of the small subunit is unknown.   Gluconate dehydrogenases and fructose dehydrogenases are also included in this entry. 
Probab=35.23  E-value=25  Score=27.80  Aligned_cols=7  Identities=57%  Similarity=0.629  Sum_probs=5.8

Q ss_pred             hhHHHHH
Q 032127           54 SKRRLLL   60 (147)
Q Consensus        54 ~~RR~aL   60 (147)
                      .+||++|
T Consensus         2 ~sRR~~L    8 (168)
T PF12318_consen    2 LSRRRLL    8 (168)
T ss_pred             CcHHHHH
Confidence            5799998


No 16 
>PRK05363 TMAO/DMSO reductase; Reviewed
Probab=33.30  E-value=71  Score=28.15  Aligned_cols=10  Identities=30%  Similarity=0.298  Sum_probs=7.4

Q ss_pred             hhhHHHHHHH
Q 032127           53 KSKRRLLLMG   62 (147)
Q Consensus        53 ~~~RR~aL~g   62 (147)
                      =..||+.|.+
T Consensus        20 ~~~rr~~l~~   29 (319)
T PRK05363         20 YLNRRRFLKA   29 (319)
T ss_pred             HHHHHHHHHH
Confidence            3479999964


No 17 
>PF12559 Inhibitor_I10:  Serine endopeptidase inhibitors;  InterPro: IPR022217  This family includes both microviridins and marinostatins. It seems likely that in both cases it is the C terminus which becomes the active inhibitor after post-translational modifications of the full length, pre-peptide. it is the ester linkages within the key, 12-residue. region that circularise the molecule giving it its inhibitory conformation. ; PDB: 1IXU_A.
Probab=28.68  E-value=22  Score=23.85  Aligned_cols=12  Identities=50%  Similarity=0.933  Sum_probs=3.9

Q ss_pred             CeEEeccCCceE
Q 032127           94 GYSYVYPSDWTE  105 (147)
Q Consensus        94 GysflyPs~W~e  105 (147)
                      .+++-||++|.|
T Consensus        44 ~~TlKyPSD~ee   55 (56)
T PF12559_consen   44 IQTLKYPSDWEE   55 (56)
T ss_dssp             -----SS-SS--
T ss_pred             CcceeCCCcccc
Confidence            489999999975


No 18 
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=27.90  E-value=43  Score=30.63  Aligned_cols=30  Identities=17%  Similarity=0.385  Sum_probs=23.7

Q ss_pred             ccccccccCCcc---cceeCCCCeEEeccCCce
Q 032127           75 SLFAQEIPKNYD---AFVDRIDGYSYVYPSDWT  104 (147)
Q Consensus        75 aA~ae~~p~g~~---~f~d~~dGysflyPs~W~  104 (147)
                      ..||+.+..||.   .|.-.+=|++|.||.+|+
T Consensus       274 ~lyGDSp~eGyvRgq~FlH~~Lg~tf~~P~Gf~  306 (479)
T COG4784         274 LLYGDSPQEGYVRGQTFLHPELGVTFDVPDGFK  306 (479)
T ss_pred             cccCCCcccceecccceeccccceEEecCCceE
Confidence            347877767775   467778999999999995


No 19 
>PF08786 DUF1795:  Domain of unknown function (DUF1795);  InterPro: IPR014894 This is a bacterial protein of unknown function. It forms an antiparallel beta sheet structure and contains some alpha helical regions. ; PDB: 1TU1_A 3LYD_A.
Probab=25.27  E-value=61  Score=23.50  Aligned_cols=43  Identities=16%  Similarity=0.205  Sum_probs=19.0

Q ss_pred             EEeccCCceEeeecCCcceecCcccCccceEEEEecC-CCCCcccC
Q 032127           96 SYVYPSDWTEFEFTGHDSGFKDRYLQLQNVRVRFIPT-DKKDVHDL  140 (147)
Q Consensus        96 sflyPs~W~ev~~~G~d~~f~D~~~~~eNVsV~Vsp~-~~~sI~df  140 (147)
                      +|..|.+|+....  +..++.|.-...-|+.|.-.+. +..++++|
T Consensus         3 ~~~lP~~~~D~t~--nv~~~~~~~~~~~slvIsR~~l~~g~tl~~~   46 (130)
T PF08786_consen    3 SLTLPDGWQDRTM--NVLVLPDSGGSGPSLVISRDPLPDGETLEDY   46 (130)
T ss_dssp             EEEEETTSEE--B--EEEEE--BTTB-EEEEEEEE---TTS-HHHH
T ss_pred             eEeCCCcceeceE--EEEEccCCCCCcceEEEEeccCCCCCCHHHH
Confidence            5778999976432  2344555433344444444444 35555543


No 20 
>TIGR01409 TAT_signal_seq Tat (twin-arginine translocation) pathway signal sequence. Members with small amino acid side chains at the -1 and -3 positions from the C-terminus of the model should be predicted to be cleaved as are Sec pathway signal sequences. Members are almost exclusively bacterial, although archaeal sequences are also found. A large fraction of the members of this family may have bound redox-active cofactors.
Probab=24.51  E-value=53  Score=18.52  Aligned_cols=12  Identities=42%  Similarity=0.454  Sum_probs=8.2

Q ss_pred             hhHHHHHHHHHH
Q 032127           54 SKRRLLLMGAGL   65 (147)
Q Consensus        54 ~~RR~aL~g~aa   65 (147)
                      ++||+.|-..++
T Consensus         1 ~sRR~Flk~~~~   12 (29)
T TIGR01409         1 LSRRDFLKGAAA   12 (29)
T ss_pred             CchhhhHHHHHH
Confidence            379999984433


No 21 
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=24.09  E-value=15  Score=28.56  Aligned_cols=14  Identities=21%  Similarity=0.401  Sum_probs=10.5

Q ss_pred             CCCcccCCCccccC
Q 032127          134 KKDVHDLGPMEEFL  147 (147)
Q Consensus       134 ~~sI~dfGsPeeva  147 (147)
                      ..=+++||+|+|+|
T Consensus        44 eeii~~LG~P~~iA   57 (181)
T PF08006_consen   44 EEIIAELGSPKEIA   57 (181)
T ss_pred             HHHHHHcCCHHHHH
Confidence            45578899998865


No 22 
>PF10633 NPCBM_assoc:  NPCBM-associated, NEW3 domain of alpha-galactosidase;  InterPro: IPR018905 This domain has been named NEW3, but its function is not known. It is found on proteins which are bacterial galactosidases [].; PDB: 1EUT_A 2BZD_A 1WCQ_C 2BER_A 1W8O_A 1EUU_A 1W8N_A.
Probab=23.72  E-value=85  Score=20.83  Aligned_cols=36  Identities=14%  Similarity=0.126  Sum_probs=15.0

Q ss_pred             CCeEEeccCCceEeeecCCcceecCcccC--ccceEEEEecC
Q 032127           93 DGYSYVYPSDWTEFEFTGHDSGFKDRYLQ--LQNVRVRFIPT  132 (147)
Q Consensus        93 dGysflyPs~W~ev~~~G~d~~f~D~~~~--~eNVsV~Vsp~  132 (147)
                      -..++..|.+|. +...+..+.   .+.+  ...+.+.|.+.
T Consensus        24 v~~~l~~P~GW~-~~~~~~~~~---~l~pG~s~~~~~~V~vp   61 (78)
T PF10633_consen   24 VSLSLSLPEGWT-VSASPASVP---SLPPGESVTVTFTVTVP   61 (78)
T ss_dssp             -EEEEE--TTSE----EEEEE-----B-TTSEEEEEEEEEE-
T ss_pred             EEEEEeCCCCcc-ccCCccccc---cCCCCCEEEEEEEEECC
Confidence            356678899998 444443333   3333  44455555544


No 23 
>PRK10123 wcaM putative colanic acid biosynthesis protein; Provisional
Probab=23.67  E-value=1.4e+02  Score=26.91  Aligned_cols=25  Identities=16%  Similarity=0.429  Sum_probs=18.2

Q ss_pred             CccceEEEEecCC----CCCcccCCCccc
Q 032127          121 QLQNVRVRFIPTD----KKDVHDLGPMEE  145 (147)
Q Consensus       121 ~~eNVsV~Vsp~~----~~sI~dfGsPee  145 (147)
                      .+.|+.+.|...|    .-.+.-||+..+
T Consensus       111 ~~hnitldvrgsdc~ikgiamsgfgpvtq  139 (464)
T PRK10123        111 SMHNITLDVRGSDCTIKGLAMSGFGPVTQ  139 (464)
T ss_pred             eeeeEEEeeccCceEEeeeeecccCceeE
Confidence            6789998888765    345677887654


No 24 
>PRK07474 sulfur oxidation protein SoxY; Provisional
Probab=22.57  E-value=67  Score=25.39  Aligned_cols=9  Identities=33%  Similarity=0.279  Sum_probs=7.5

Q ss_pred             hhhHHHHHH
Q 032127           53 KSKRRLLLM   61 (147)
Q Consensus        53 ~~~RR~aL~   61 (147)
                      ..+||++|.
T Consensus         7 ~~~rr~~l~   15 (154)
T PRK07474          7 ALSRRQALA   15 (154)
T ss_pred             CcCHHHHHH
Confidence            478999998


No 25 
>PF05984 Cytomega_UL20A:  Cytomegalovirus UL20A protein;  InterPro: IPR009245 This family consists of several Cytomegalovirus UL20A proteins. UL20A is thought to be a glycoprotein [].
Probab=21.80  E-value=59  Score=23.92  Aligned_cols=16  Identities=25%  Similarity=0.353  Sum_probs=11.9

Q ss_pred             hHHHHHHHHHHHhhhh
Q 032127           55 KRRLLLMGAGLLTANL   70 (147)
Q Consensus        55 ~RR~aL~g~aa~~a~~   70 (147)
                      .||..|++.+|+...+
T Consensus         2 aRRlwiLslLAVtLtV   17 (100)
T PF05984_consen    2 ARRLWILSLLAVTLTV   17 (100)
T ss_pred             chhhHHHHHHHHHHHH
Confidence            5899998888765444


No 26 
>TIGR02543 List_Bact_rpt Listeria/Bacterioides repeat. This model describes a conserved core region, about 43 residues in length, of at least two families of tandem repeats. These include 78-residue repeats from 2 to 15 in number, in some proteins of Bacteroides forsythus ATCC 43037, and 70-residue repeats in families of internalins of Listeria species. Single copies are found in proteins of Fibrobacter succinogenes, Geobacter sulfurreducens, and a few bacteria.
Probab=21.55  E-value=96  Score=19.23  Aligned_cols=34  Identities=18%  Similarity=0.403  Sum_probs=17.9

Q ss_pred             CCCCeEEeccCCc-eEeeecCCcceecCcccCccceEE
Q 032127           91 RIDGYSYVYPSDW-TEFEFTGHDSGFKDRYLQLQNVRV  127 (147)
Q Consensus        91 ~~dGysflyPs~W-~ev~~~G~d~~f~D~~~~~eNVsV  127 (147)
                      .++||.|.   || ..-++.++.--|-......+|+.|
T Consensus         2 ~k~GY~F~---GWY~d~~~~~~~~~~~~~~~~~~d~tl   36 (44)
T TIGR02543         2 TKPGYVFD---GWYGDSAFTTTVWNFTPDDMPTKDITL   36 (44)
T ss_pred             CcCCcEee---eeEEcCCCCeeeEEecCCcccCCCEEE
Confidence            46899995   78 433333343334443334555544


No 27 
>PLN00058 photosystem II reaction center subunit T; Provisional
Probab=20.60  E-value=84  Score=23.45  Aligned_cols=15  Identities=27%  Similarity=0.383  Sum_probs=10.3

Q ss_pred             chhhhHHHHHHHHHH
Q 032127           51 ENKSKRRLLLMGAGL   65 (147)
Q Consensus        51 ~~~~~RR~aL~g~aa   65 (147)
                      +...+||.++..++|
T Consensus        46 e~~~gRR~~mfaaaA   60 (103)
T PLN00058         46 QSTTMRRDLMFTAAA   60 (103)
T ss_pred             cchhhHHHHHHHHHH
Confidence            456789999874444


Done!