BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032133
         (146 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain
          Length = 60

 Score = 27.3 bits (59), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 3/26 (11%)

Query: 26 GSHMGFSCYSMEEAKKNMYAFSTTTY 51
          GSHM F+ + +EE +K   AFS T Y
Sbjct: 1  GSHMTFTSFQLEELEK---AFSRTHY 23


>pdb|2P6W|A Chain A, Crystal Structure Of A Glycosyltransferase Involved In
          The Glycosylation Of The Major Capsid Of Pbcv-1
 pdb|2P73|A Chain A, Crystal Structure Of A Glycosyltransferase Involved In
          The Glycosylation Of The Major Capsid Of Pbcv-1
 pdb|2P72|A Chain A, Crystal Structure Of A Glycosyltransferase Involved In
          The Glycosylation Of The Major Capsid Of Pbcv-1
 pdb|2P72|B Chain B, Crystal Structure Of A Glycosyltransferase Involved In
          The Glycosylation Of The Major Capsid Of Pbcv-1
          Length = 213

 Score = 26.6 bits (57), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 58 VSEETSEKFKGLPGVLWVLPDSYIDVKNKD 87
          + ++ +EKF      LW+  D Y++ KNK+
Sbjct: 62 IIQQAAEKFPSTEWFLWLDSDVYVNPKNKN 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.130    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,743,593
Number of Sequences: 62578
Number of extensions: 203673
Number of successful extensions: 262
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 261
Number of HSP's gapped (non-prelim): 5
length of query: 146
length of database: 14,973,337
effective HSP length: 90
effective length of query: 56
effective length of database: 9,341,317
effective search space: 523113752
effective search space used: 523113752
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 46 (22.3 bits)