BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032134
(146 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NRA|A Chain A, Crystal Structure Of An Aspartate Aminotransferase
(Yp_354942.1) From Rhodobacter Sphaeroides 2.4.1 At 2.15
A Resolution
pdb|3NRA|B Chain B, Crystal Structure Of An Aspartate Aminotransferase
(Yp_354942.1) From Rhodobacter Sphaeroides 2.4.1 At 2.15
A Resolution
Length = 407
Score = 26.6 bits (57), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 15/54 (27%), Positives = 27/54 (50%)
Query: 2 TAVSNSLVLPKNPRVELSSGSFLKPLDLCLGSNTPANLSFSPNHQWKVQLSSSR 55
T + S + P+ P++ ++ F+K L L G FSP+ V+L+ S+
Sbjct: 333 TPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQ 386
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.131 0.378
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,431,280
Number of Sequences: 62578
Number of extensions: 103401
Number of successful extensions: 191
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 189
Number of HSP's gapped (non-prelim): 2
length of query: 146
length of database: 14,973,337
effective HSP length: 90
effective length of query: 56
effective length of database: 9,341,317
effective search space: 523113752
effective search space used: 523113752
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)