Citrus Sinensis ID: 032150
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| 297845042 | 141 | hypothetical protein ARALYDRAFT_472304 [ | 0.931 | 0.964 | 0.765 | 4e-51 | |
| 79318286 | 142 | high mobility group B2 protein [Arabidop | 0.972 | 1.0 | 0.708 | 1e-48 | |
| 8886929 | 662 | F2D10.18 [Arabidopsis thaliana] | 0.952 | 0.209 | 0.709 | 7e-48 | |
| 145323962 | 140 | high mobility group B3 protein [Arabidop | 0.931 | 0.971 | 0.723 | 2e-47 | |
| 308569654 | 146 | high mobility group box 2 protein [Gossy | 0.773 | 0.773 | 0.859 | 1e-46 | |
| 312281681 | 144 | unnamed protein product [Thellungiella h | 0.876 | 0.888 | 0.746 | 2e-46 | |
| 312282031 | 141 | unnamed protein product [Thellungiella h | 0.856 | 0.886 | 0.738 | 2e-45 | |
| 308569660 | 142 | high mobility group box 1 protein [Gossy | 0.863 | 0.887 | 0.838 | 5e-45 | |
| 224083306 | 160 | high mobility group family [Populus tric | 0.842 | 0.768 | 0.736 | 9e-45 | |
| 18394900 | 141 | high mobility group B3 protein [Arabidop | 0.856 | 0.886 | 0.723 | 1e-43 |
| >gi|297845042|ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] gi|297336244|gb|EFH66661.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Score = 205 bits (522), Expect = 4e-51, Method: Compositional matrix adjust.
Identities = 108/141 (76%), Positives = 127/141 (90%), Gaps = 5/141 (3%)
Query: 1 MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDH 60
MKGGKSK++TRNAKLSV KKPAK G+ AAKDPNKPKRP+SAFFVFME+FRE YKK+H
Sbjct: 3 MKGGKSKTETRNAKLSVTKKPAKGGKG---AAKDPNKPKRPSSAFFVFMEDFRETYKKEH 59
Query: 61 PKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPEEEE 120
PKNKSVAAVGKAGGEKWKS+S+++KAPYVAKA+KRKVEYEK+MK YN++ EG P+E+E
Sbjct: 60 PKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLEEG--PKEDE 117
Query: 121 ESEKSMSEVNDEDDDEEGSGE 141
ES+KS+SEVNDEDD E+GS E
Sbjct: 118 ESDKSVSEVNDEDDAEDGSEE 138
|
Source: Arabidopsis lyrata subsp. lyrata Species: Arabidopsis lyrata Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|79318286|ref|NP_001031074.1| high mobility group B2 protein [Arabidopsis thaliana] gi|297845040|ref|XP_002890401.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. lyrata] gi|297336243|gb|EFH66660.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. lyrata] gi|332191886|gb|AEE30007.1| high mobility group B2 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|8886929|gb|AAF80615.1|AC069251_8 F2D10.18 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|145323962|ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis thaliana] gi|332191890|gb|AEE30011.1| high mobility group B3 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|308569654|gb|ADO34793.1| high mobility group box 2 protein [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|312281681|dbj|BAJ33706.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|312282031|dbj|BAJ33881.1| unnamed protein product [Thellungiella halophila] | Back alignment and taxonomy information |
|---|
| >gi|308569660|gb|ADO34795.1| high mobility group box 1 protein [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|224083306|ref|XP_002306980.1| high mobility group family [Populus trichocarpa] gi|222856429|gb|EEE93976.1| high mobility group family [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|18394900|ref|NP_564124.1| high mobility group B3 protein [Arabidopsis thaliana] gi|75220405|sp|P93047.1|HMGB3_ARATH RecName: Full=High mobility group B protein 3; AltName: Full=High mobility group protein B 2; Short=AtHMGbeta2; Short=HMG beta 2; AltName: Full=Nucleosome/chromatin assembly factor group D 03; Short=Nucleosome/chromatin assembly factor group D 3 gi|15724174|gb|AAL06479.1|AF411789_1 At1g20690/F2D10_15 [Arabidopsis thaliana] gi|1694976|emb|CAA70691.1| HMG1 [Arabidopsis thaliana] gi|2832361|emb|CAA74402.1| HMG protein [Arabidopsis thaliana] gi|20453325|gb|AAM19901.1| At1g20690/F2D10_15 [Arabidopsis thaliana] gi|21537072|gb|AAM61413.1| unknown [Arabidopsis thaliana] gi|22530942|gb|AAM96975.1| expressed protein [Arabidopsis thaliana] gi|23198424|gb|AAN15739.1| expressed protein [Arabidopsis thaliana] gi|332191888|gb|AEE30009.1| high mobility group B3 protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 146 | ||||||
| TAIR|locus:505006135 | 144 | HMGB2 "high mobility group B2" | 0.787 | 0.798 | 0.643 | 1.3e-36 | |
| TAIR|locus:2053893 | 138 | HMGB4 "high mobility group B4" | 0.760 | 0.804 | 0.491 | 1.4e-25 | |
| TAIR|locus:2128003 | 125 | HMGB5 "high mobility group B5" | 0.561 | 0.656 | 0.5 | 1e-20 | |
| MGI|MGI:1098219 | 200 | Hmgb3 "high mobility group box | 0.554 | 0.405 | 0.457 | 4.8e-17 | |
| UNIPROTKB|F1RQ19 | 202 | LOC100517745 "Uncharacterized | 0.554 | 0.400 | 0.445 | 4.8e-17 | |
| RGD|1564407 | 200 | Hmgb3 "high mobility group box | 0.554 | 0.405 | 0.445 | 6e-17 | |
| UNIPROTKB|Q32L31 | 200 | HMGB3 "High mobility group pro | 0.554 | 0.405 | 0.445 | 6e-17 | |
| UNIPROTKB|E7EQU1 | 193 | HMGB3 "High mobility group pro | 0.554 | 0.419 | 0.433 | 6e-17 | |
| UNIPROTKB|E7ES08 | 188 | HMGB3 "High mobility group pro | 0.554 | 0.430 | 0.433 | 6e-17 | |
| UNIPROTKB|O15347 | 200 | HMGB3 "High mobility group pro | 0.554 | 0.405 | 0.433 | 6e-17 |
| TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 394 (143.8 bits), Expect = 1.3e-36, P = 1.3e-36
Identities = 74/115 (64%), Positives = 91/115 (79%)
Query: 1 MKGGKSKSDTRNAKLSVNXXXXXXXXXXXXXXXDPNKPKRPASAFFVFMEEFREQYKKDH 60
MKG KSK++TR++KLSV DPNKPKRPASAFFVFME+FRE +KK++
Sbjct: 1 MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKEN 60
Query: 61 PKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTK 115
PKNKSVA VGKA G+KWKS+S+++KAPYVAKAEKRKVEYEK++K YN++ EG K
Sbjct: 61 PKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPK 115
|
|
| TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1098219 Hmgb3 "high mobility group box 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RQ19 LOC100517745 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1564407 Hmgb3 "high mobility group box 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32L31 HMGB3 "High mobility group protein B3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EQU1 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ES08 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O15347 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh2_kg.1__2258__AT1G20696.3 | annotation not avaliable (141 aa) | |||||||
(Arabidopsis lyrata) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| pfam00505 | 69 | pfam00505, HMG_box, HMG (high mobility group) box | 3e-17 | |
| cd01390 | 66 | cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class | 3e-15 | |
| cd00084 | 66 | cd00084, HMG-box, High Mobility Group (HMG)-box is | 9e-15 | |
| smart00398 | 70 | smart00398, HMG, high mobility group | 6e-13 | |
| COG5648 | 211 | COG5648, NHP6B, Chromatin-associated proteins cont | 2e-08 | |
| PTZ00199 | 94 | PTZ00199, PTZ00199, high mobility group protein; P | 2e-08 | |
| pfam09011 | 69 | pfam09011, DUF1898, Domain of unknown function (DU | 1e-07 | |
| cd01388 | 72 | cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I | 3e-07 |
| >gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box | Back alignment and domain information |
|---|
Score = 70.3 bits (173), Expect = 3e-17
Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 1/70 (1%)
Query: 38 PKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKV 97
PKRP SAFF+F +E R + K ++P K A + K GEKWK++SE +K PY KAEK K
Sbjct: 1 PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEEKKPYEEKAEKEKA 59
Query: 98 EYEKDMKNYN 107
YEK Y
Sbjct: 60 RYEKAYPAYK 69
|
Length = 69 |
| >gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
| >gnl|CDD|197700 smart00398, HMG, high mobility group | Back alignment and domain information |
|---|
| >gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) | Back alignment and domain information |
|---|
| >gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| PTZ00199 | 94 | high mobility group protein; Provisional | 99.94 | |
| cd01389 | 77 | MATA_HMG-box MATA_HMG-box, class I member of the H | 99.86 | |
| cd01388 | 72 | SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of | 99.85 | |
| PF00505 | 69 | HMG_box: HMG (high mobility group) box; InterPro: | 99.85 | |
| cd01390 | 66 | HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II | 99.84 | |
| smart00398 | 70 | HMG high mobility group. | 99.84 | |
| COG5648 | 211 | NHP6B Chromatin-associated proteins containing the | 99.83 | |
| PF09011 | 73 | HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi | 99.83 | |
| KOG0381 | 96 | consensus HMG box-containing protein [General func | 99.78 | |
| cd00084 | 66 | HMG-box High Mobility Group (HMG)-box is found in | 99.78 | |
| KOG0526 | 615 | consensus Nucleosome-binding factor SPN, POB3 subu | 99.73 | |
| KOG0527 | 331 | consensus HMG-box transcription factor [Transcript | 99.72 | |
| KOG3248 | 421 | consensus Transcription factor TCF-4 [Transcriptio | 99.33 | |
| KOG4715 | 410 | consensus SWI/SNF-related matrix-associated actin- | 99.26 | |
| KOG0528 | 511 | consensus HMG-box transcription factor SOX5 [Trans | 99.07 | |
| KOG2746 | 683 | consensus HMG-box transcription factor Capicua and | 98.68 | |
| PF14887 | 85 | HMG_box_5: HMG (high mobility group) box 5; PDB: 1 | 98.47 | |
| PF06382 | 183 | DUF1074: Protein of unknown function (DUF1074); In | 97.81 | |
| PF04690 | 170 | YABBY: YABBY protein; InterPro: IPR006780 YABBY pr | 97.61 | |
| COG5648 | 211 | NHP6B Chromatin-associated proteins containing the | 97.23 | |
| PF08073 | 55 | CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 | 97.04 | |
| PF04769 | 201 | MAT_Alpha1: Mating-type protein MAT alpha 1; Inter | 95.59 | |
| PF06244 | 122 | DUF1014: Protein of unknown function (DUF1014); In | 95.47 | |
| TIGR03481 | 198 | HpnM hopanoid biosynthesis associated membrane pro | 89.97 | |
| PRK15117 | 211 | ABC transporter periplasmic binding protein MlaC; | 87.46 | |
| KOG3223 | 221 | consensus Uncharacterized conserved protein [Funct | 85.67 |
| >PTZ00199 high mobility group protein; Provisional | Back alignment and domain information |
|---|
Probab=99.94 E-value=2e-26 Score=157.77 Aligned_cols=89 Identities=44% Similarity=0.696 Sum_probs=83.3
Q ss_pred cCCCCccCccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCC--HHHHHHHHHHHhcCCChHhhHhHHHHHHHH
Q 032150 18 NKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKS--VAAVGKAGGEKWKSMSEADKAPYVAKAEKR 95 (146)
Q Consensus 18 ~k~~~~~~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~--~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~ 95 (146)
++.+.+.+++++++.+||++||||+|||||||+++|..|..+||+ ++ +++|+++||++|+.||+++|.+|.++|..+
T Consensus 3 ~~~~~~~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~-~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~d 81 (94)
T PTZ00199 3 KKQGKVLVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPE-LAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQED 81 (94)
T ss_pred ccccCccccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcC-CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Confidence 356777778888889999999999999999999999999999999 64 899999999999999999999999999999
Q ss_pred HHHHHHHHHHhH
Q 032150 96 KVEYEKDMKNYN 107 (146)
Q Consensus 96 k~~Y~~e~~~y~ 107 (146)
+.+|..+|..|+
T Consensus 82 k~rY~~e~~~Y~ 93 (94)
T PTZ00199 82 KVRYEKEKAEYA 93 (94)
T ss_pred HHHHHHHHHHHh
Confidence 999999999996
|
|
| >cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin | Back alignment and domain information |
|---|
| >cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00398 HMG high mobility group | Back alignment and domain information |
|---|
| >COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins | Back alignment and domain information |
|---|
| >KOG0381 consensus HMG box-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors | Back alignment and domain information |
|---|
| >KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0527 consensus HMG-box transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3248 consensus Transcription factor TCF-4 [Transcription] | Back alignment and domain information |
|---|
| >KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] | Back alignment and domain information |
|---|
| >KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] | Back alignment and domain information |
|---|
| >PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A | Back alignment and domain information |
|---|
| >PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta | Back alignment and domain information |
|---|
| >PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] | Back alignment and domain information |
|---|
| >COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] | Back alignment and domain information |
|---|
| >PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM | Back alignment and domain information |
|---|
| >PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional | Back alignment and domain information |
|---|
| >KOG3223 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 146 | ||||
| 1j3c_A | 79 | Solution Structure Of The C-Terminal Domain Of The | 2e-12 | ||
| 2yqi_A | 81 | Solution Structure Of The Second Hmg-Box Domain Fro | 4e-12 | ||
| 1j3d_A | 78 | Solution Structure Of The C-Terminal Domain Of The | 4e-12 | ||
| 1hme_A | 77 | Structure Of The Hmg Box Motif In The B-Domain Of H | 4e-11 | ||
| 2gzk_A | 159 | Structure Of A Complex Of Tandem Hmg Boxes And Dna | 6e-11 | ||
| 2yrq_A | 173 | Solution Structure Of The Tandem Hmg Box Domain Fro | 7e-11 | ||
| 1nhm_A | 81 | The Structure Of The Hmg Box And Its Interaction Wi | 9e-10 | ||
| 1hsm_A | 79 | The Structure Of The Hmg Box And Its Interaction Wi | 4e-09 | ||
| 1j5n_A | 93 | Solution Structure Of The Non-Sequence-Specific Hmg | 6e-09 | ||
| 1cg7_A | 93 | Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len | 7e-09 | ||
| 2lhj_A | 97 | Nmr Structure Of The High Mobility Group Protein-Li | 6e-08 | ||
| 1qrv_A | 73 | Crystal Structure Of The Complex Of Hmg-D And Dna L | 2e-07 | ||
| 1e7j_A | 74 | Hmg-D Complexed To A Bulge Dna Length = 74 | 2e-07 | ||
| 1hma_A | 73 | The Solution Structure And Dynamics Of The Dna Bind | 2e-07 | ||
| 1j3x_A | 77 | Solution Structure Of The N-Terminal Domain Of The | 3e-07 | ||
| 3nm9_A | 73 | Hmgd(M13a)-Dna Complex Length = 73 | 3e-07 | ||
| 2ly4_A | 83 | Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-Bo | 2e-06 | ||
| 1wxl_A | 73 | Solution Structure Of The Hmg-Box Domain In The Ssr | 4e-06 | ||
| 1aab_A | 83 | Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 | 4e-06 | ||
| 4euw_A | 106 | Crystal Structure Of A Hmg Domain Of Transcription | 6e-06 | ||
| 4a3n_A | 71 | Crystal Structure Of Hmg-Box Of Human Sox17 Length | 7e-06 | ||
| 2yul_A | 82 | Solution Structure Of The Hmg Box Of Human Transcri | 7e-06 | ||
| 3f27_D | 83 | Structure Of Sox17 Bound To Dna Length = 83 | 7e-06 | ||
| 2crj_A | 92 | Solution Structure Of The Hmg Domain Of Mouse Hmg D | 1e-05 | ||
| 1ckt_A | 71 | Crystal Structure Of Hmg1 Domain A Bound To A Cispl | 6e-05 | ||
| 1o4x_B | 88 | Ternary Complex Of The Dna Binding Domains Of The O | 8e-05 | ||
| 3tq6_A | 214 | Crystal Structure Of Human Mitochondrial Transcript | 9e-05 | ||
| 3u2b_C | 79 | Structure Of The Sox4 Hmg Domain Bound To Dna Lengt | 1e-04 | ||
| 3fgh_A | 67 | Human Mitochondrial Transcription Factor A Box B Le | 1e-04 | ||
| 2e6o_A | 87 | Solution Structure Of The Hmg Box Domain From Human | 2e-04 | ||
| 1wgf_A | 90 | Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 | 2e-04 | ||
| 1j47_A | 85 | 3d Solution Nmr Structure Of The M9i Mutant Of The | 4e-04 | ||
| 1hrz_A | 76 | The 3d Structure Of The Human Sry-Dna Complex Solve | 4e-04 | ||
| 1k99_A | 99 | Solution Structure Of The First Hmg Box In Human Up | 4e-04 | ||
| 1j46_A | 85 | 3d Solution Nmr Structure Of The Wild Type Hmg-Box | 4e-04 | ||
| 3tmm_A | 238 | Tfam Imposes A U-Turn On Mitochondrial Dna Length = | 5e-04 | ||
| 1gt0_D | 80 | Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le | 6e-04 | ||
| 2le4_A | 81 | Solution Structure Of The Hmg Box Dna-Binding Domai | 6e-04 | ||
| 2eqz_A | 86 | Solution Structure Of The First Hmg-Box Domain From | 7e-04 |
| >pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 | Back alignment and structure |
|
| >pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 | Back alignment and structure |
| >pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 | Back alignment and structure |
| >pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 | Back alignment and structure |
| >pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 | Back alignment and structure |
| >pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 | Back alignment and structure |
| >pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 | Back alignment and structure |
| >pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 | Back alignment and structure |
| >pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 | Back alignment and structure |
| >pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 | Back alignment and structure |
| >pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 | Back alignment and structure |
| >pdb|1QRV|A Chain A, Crystal Structure Of The Complex Of Hmg-D And Dna Length = 73 | Back alignment and structure |
| >pdb|1E7J|A Chain A, Hmg-D Complexed To A Bulge Dna Length = 74 | Back alignment and structure |
| >pdb|1HMA|A Chain A, The Solution Structure And Dynamics Of The Dna Binding Domain Of Hmg-D From Drosophila Melanogaster Length = 73 | Back alignment and structure |
| >pdb|1J3X|A Chain A, Solution Structure Of The N-Terminal Domain Of The Hmgb2 Length = 77 | Back alignment and structure |
| >pdb|3NM9|A Chain A, Hmgd(M13a)-Dna Complex Length = 73 | Back alignment and structure |
| >pdb|2LY4|A Chain A, Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-BoxP53 Transactivation Domain Interaction And Is Regulated By The Acidic Tail Length = 83 | Back alignment and structure |
| >pdb|1WXL|A Chain A, Solution Structure Of The Hmg-Box Domain In The Ssrp1 Subunit Of Fact Length = 73 | Back alignment and structure |
| >pdb|1AAB|A Chain A, Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 | Back alignment and structure |
| >pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 | Back alignment and structure |
| >pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 | Back alignment and structure |
| >pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 | Back alignment and structure |
| >pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 | Back alignment and structure |
| >pdb|2CRJ|A Chain A, Solution Structure Of The Hmg Domain Of Mouse Hmg Domain Protein Hmgx2 Length = 92 | Back alignment and structure |
| >pdb|1CKT|A Chain A, Crystal Structure Of Hmg1 Domain A Bound To A Cisplatin-modified Dna Duplex Length = 71 | Back alignment and structure |
| >pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 | Back alignment and structure |
| >pdb|3TQ6|A Chain A, Crystal Structure Of Human Mitochondrial Transcription Factor A, Tfam Or Mttfa, Bound To The Light Strand Promoter Lsp Length = 214 | Back alignment and structure |
| >pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 | Back alignment and structure |
| >pdb|3FGH|A Chain A, Human Mitochondrial Transcription Factor A Box B Length = 67 | Back alignment and structure |
| >pdb|2E6O|A Chain A, Solution Structure Of The Hmg Box Domain From Human Hmg-Box Transcription Factor 1 Length = 87 | Back alignment and structure |
| >pdb|1WGF|A Chain A, Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 Length = 90 | Back alignment and structure |
| >pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 | Back alignment and structure |
| >pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 | Back alignment and structure |
| >pdb|1K99|A Chain A, Solution Structure Of The First Hmg Box In Human Upstream Binding Factor Length = 99 | Back alignment and structure |
| >pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 | Back alignment and structure |
| >pdb|3TMM|A Chain A, Tfam Imposes A U-Turn On Mitochondrial Dna Length = 238 | Back alignment and structure |
| >pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 | Back alignment and structure |
| >pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 | Back alignment and structure |
| >pdb|2EQZ|A Chain A, Solution Structure Of The First Hmg-Box Domain From High Mobility Group Protein B3 Length = 86 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 146 | |||
| 1hme_A | 77 | High mobility group protein fragment-B; DNA-bindin | 6e-23 | |
| 2lhj_A | 97 | High mobility group protein homolog NHP1; structur | 6e-22 | |
| 1cg7_A | 93 | Protein (NON histone protein 6 A); HMG BOX, DNA be | 8e-22 | |
| 2crj_A | 92 | SWI/SNF-related matrix-associated actin- dependent | 1e-21 | |
| 1aab_A | 83 | High mobility group protein; HMG-BOX, DNA-binding; | 5e-21 | |
| 2eqz_A | 86 | High mobility group protein B3; HMG-box domain, mo | 6e-21 | |
| 2co9_A | 102 | Thymus high mobility group box protein TOX; TOX pr | 9e-21 | |
| 1k99_A | 99 | Upstream binding factor 1; alpha-helix, L-shape, D | 2e-19 | |
| 3nm9_A | 73 | HMG-D, high mobility group protein D; DNA bending, | 9e-18 | |
| 1wxl_A | 73 | Single-strand recognition protein; FACT, SSRP1, HM | 1e-17 | |
| 1ckt_A | 71 | High mobility group 1 protein; high-mobility group | 1e-17 | |
| 1wgf_A | 90 | Upstream binding factor 1; transcription factor, D | 1e-17 | |
| 2cs1_A | 92 | PMS1 protein homolog 1; DNA mismatch repair protei | 2e-16 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 3e-16 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 2e-11 | |
| 3fgh_A | 67 | Transcription factor A, mitochondrial; HMG domain, | 8e-16 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 4e-14 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 3e-13 | |
| 2e6o_A | 87 | HMG box-containing protein 1; HMG-box domain, HMG- | 6e-13 | |
| 1wz6_A | 82 | HMG-box transcription factor BBX; bobby SOX homolo | 1e-12 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 8e-12 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 2e-09 | |
| 4a3n_A | 71 | Transcription factor SOX-17; 2.40A {Homo sapiens} | 7e-11 | |
| 4euw_A | 106 | Transcription factor SOX-9; protein-DNA complex, H | 1e-10 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 4e-10 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 8e-09 | |
| 1hry_A | 76 | Human SRY; DNA, DNA-binding protein, DNA binding p | 1e-09 | |
| 3f27_D | 83 | Transcription factor SOX-17; protein-DNA complex, | 6e-09 | |
| 3u2b_C | 79 | Transcription factor SOX-4; HMG domain, transcript | 7e-09 | |
| 1j46_A | 85 | SRY, sex-determining region Y protein; MALE sex de | 1e-08 | |
| 1i11_A | 81 | Transcription factor SOX-5; HMG BOX, DNA bending, | 2e-08 | |
| 2lef_A | 86 | LEF-1 HMG, protein (lymphoid enhancer-binding fact | 2e-08 | |
| 1gt0_D | 80 | Transcription factor SOX-2; POU factors, SOX prote | 6e-08 | |
| 2d7l_A | 81 | WD repeat and HMG-box DNA binding protein 1; high | 3e-06 | |
| 1v63_A | 101 | Nucleolar transcription factor 1; DNA binding, str | 4e-06 | |
| 1v64_A | 108 | Nucleolar transcription factor 1; DNA binding, str | 1e-05 |
| >1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 | Back alignment and structure |
|---|
Score = 85.0 bits (211), Expect = 6e-23
Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
Query: 33 KDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKA 92
KDPN PKRP SAFF+F E+R + K +HP S+ V K GE W + + DK PY KA
Sbjct: 2 KDPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKA 60
Query: 93 EKRKVEYEKDMKNYNRR 109
K K +YEKD+ Y +
Sbjct: 61 AKLKEKYEKDIAAYRAK 77
|
| >2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 | Back alignment and structure |
|---|
| >1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 | Back alignment and structure |
|---|
| >2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 | Back alignment and structure |
|---|
| >1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 | Back alignment and structure |
|---|
| >2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 | Back alignment and structure |
|---|
| >1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 | Back alignment and structure |
|---|
| >3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 | Back alignment and structure |
|---|
| >1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 | Back alignment and structure |
|---|
| >1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 | Back alignment and structure |
|---|
| >1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 | Back alignment and structure |
|---|
| >2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 | Back alignment and structure |
|---|
| >3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 | Back alignment and structure |
|---|
| >2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 | Back alignment and structure |
|---|
| >3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 | Back alignment and structure |
|---|
| >3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 | Back alignment and structure |
|---|
| >1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 | Back alignment and structure |
|---|
| >1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 | Back alignment and structure |
|---|
| >2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 | Back alignment and structure |
|---|
| >1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 | Back alignment and structure |
|---|
| >2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 | Back alignment and structure |
|---|
| >1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| 2co9_A | 102 | Thymus high mobility group box protein TOX; TOX pr | 99.94 | |
| 2eqz_A | 86 | High mobility group protein B3; HMG-box domain, mo | 99.93 | |
| 1k99_A | 99 | Upstream binding factor 1; alpha-helix, L-shape, D | 99.93 | |
| 1hme_A | 77 | High mobility group protein fragment-B; DNA-bindin | 99.92 | |
| 1cg7_A | 93 | Protein (NON histone protein 6 A); HMG BOX, DNA be | 99.92 | |
| 2e6o_A | 87 | HMG box-containing protein 1; HMG-box domain, HMG- | 99.92 | |
| 2crj_A | 92 | SWI/SNF-related matrix-associated actin- dependent | 99.92 | |
| 2lhj_A | 97 | High mobility group protein homolog NHP1; structur | 99.92 | |
| 1wgf_A | 90 | Upstream binding factor 1; transcription factor, D | 99.92 | |
| 2cs1_A | 92 | PMS1 protein homolog 1; DNA mismatch repair protei | 99.92 | |
| 3nm9_A | 73 | HMG-D, high mobility group protein D; DNA bending, | 99.91 | |
| 1aab_A | 83 | High mobility group protein; HMG-BOX, DNA-binding; | 99.91 | |
| 1hry_A | 76 | Human SRY; DNA, DNA-binding protein, DNA binding p | 99.91 | |
| 1wxl_A | 73 | Single-strand recognition protein; FACT, SSRP1, HM | 99.9 | |
| 1ckt_A | 71 | High mobility group 1 protein; high-mobility group | 99.9 | |
| 1j46_A | 85 | SRY, sex-determining region Y protein; MALE sex de | 99.9 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 99.89 | |
| 1wz6_A | 82 | HMG-box transcription factor BBX; bobby SOX homolo | 99.89 | |
| 4a3n_A | 71 | Transcription factor SOX-17; 2.40A {Homo sapiens} | 99.89 | |
| 1v64_A | 108 | Nucleolar transcription factor 1; DNA binding, str | 99.89 | |
| 1gt0_D | 80 | Transcription factor SOX-2; POU factors, SOX prote | 99.89 | |
| 3f27_D | 83 | Transcription factor SOX-17; protein-DNA complex, | 99.89 | |
| 4euw_A | 106 | Transcription factor SOX-9; protein-DNA complex, H | 99.89 | |
| 2lef_A | 86 | LEF-1 HMG, protein (lymphoid enhancer-binding fact | 99.89 | |
| 3u2b_C | 79 | Transcription factor SOX-4; HMG domain, transcript | 99.88 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 99.88 | |
| 1i11_A | 81 | Transcription factor SOX-5; HMG BOX, DNA bending, | 99.88 | |
| 1l8y_A | 91 | Upstream binding factor 1; HUBF, HMG box 5, DNA bi | 99.88 | |
| 3fgh_A | 67 | Transcription factor A, mitochondrial; HMG domain, | 99.87 | |
| 2yrq_A | 173 | High mobility group protein B1; HMG box domain, DN | 99.86 | |
| 1v63_A | 101 | Nucleolar transcription factor 1; DNA binding, str | 99.86 | |
| 2d7l_A | 81 | WD repeat and HMG-box DNA binding protein 1; high | 99.85 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 99.83 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 99.83 | |
| 2yuk_A | 90 | Myeloid/lymphoid or mixed-lineage leukemia protein | 99.81 | |
| 2cto_A | 93 | Novel protein; high mobility group box domain, hel | 99.81 | |
| 3tq6_A | 214 | Transcription factor A, mitochondrial; transcripti | 99.8 | |
| 3tmm_A | 238 | Transcription factor A, mitochondrial; HMG, high m | 99.79 | |
| 2gzk_A | 159 | Sex-determining region on Y / HMGB1; protein-DNA c | 99.75 |
| >2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
Probab=99.94 E-value=7.9e-27 Score=160.75 Aligned_cols=90 Identities=28% Similarity=0.493 Sum_probs=83.6
Q ss_pred CccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhcCCChHhhHhHHHHHHHHHHHHHHHHH
Q 032150 25 GRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMK 104 (146)
Q Consensus 25 ~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~k~~Y~~e~~ 104 (146)
..+++++.+||++||||+|||||||+++|..|+.+||+ +++.+|+++||++|++|++++|++|.++|..++++|..+|.
T Consensus 5 ~~~~kk~~kdp~~pKrP~say~lF~~~~r~~i~~~~P~-~~~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~ 83 (102)
T 2co9_A 5 SSGKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPN-ATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLA 83 (102)
T ss_dssp CCCSCSSCCCCCSCCCCCCHHHHTHHHHHHHHHHHCTT-SCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34445677899999999999999999999999999999 99999999999999999999999999999999999999999
Q ss_pred HhHHhcCCCCC
Q 032150 105 NYNRRQAEGTK 115 (146)
Q Consensus 105 ~y~~k~~~~~~ 115 (146)
.|+.++.....
T Consensus 84 ~Y~~~~~~~~~ 94 (102)
T 2co9_A 84 AYRASLVSKSY 94 (102)
T ss_dssp HHHHHHTSSCC
T ss_pred HHHhhcccccc
Confidence 99999876554
|
| >2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A | Back alignment and structure |
|---|
| >1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A | Back alignment and structure |
|---|
| >2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* | Back alignment and structure |
|---|
| >1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* | Back alignment and structure |
|---|
| >1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A | Back alignment and structure |
|---|
| >1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
| >1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 | Back alignment and structure |
|---|
| >1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B | Back alignment and structure |
|---|
| >3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A | Back alignment and structure |
|---|
| >4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A | Back alignment and structure |
|---|
| >3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 | Back alignment and structure |
|---|
| >2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 146 | ||||
| d1lwma_ | 93 | a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces | 2e-15 | |
| d1hsma_ | 79 | a.21.1.1 (A:) High mobility group protein 1, HMG1 | 2e-13 | |
| d1gt0d_ | 80 | a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: | 8e-13 | |
| d1i11a_ | 70 | a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: | 1e-12 | |
| d1ckta_ | 71 | a.21.1.1 (A:) High mobility group protein 1, HMG1 | 2e-12 | |
| d1k99a_ | 91 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 5e-12 | |
| d1qrva_ | 73 | a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI | 5e-12 | |
| d1j46a_ | 85 | a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 | 8e-12 | |
| d1wgfa_ | 90 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 3e-11 | |
| d2lefa_ | 86 | a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE | 2e-10 | |
| d1v63a_ | 101 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 1e-09 | |
| d1v64a_ | 108 | a.21.1.1 (A:) Nucleolar transcription factor 1 (Up | 2e-07 |
| >d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: NHP6a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 64.9 bits (158), Expect = 2e-15
Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 1/93 (1%)
Query: 19 KKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWK 78
P + +++ + KDPN PKR SA+ F E R+ + ++P + + VGK GEKWK
Sbjct: 2 VTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENP-DITFGQVGKKLGEKWK 60
Query: 79 SMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111
+++ +K PY AKA+ K YE + + YN A
Sbjct: 61 ALTPEEKQPYEAKAQADKKRYESEKELYNATLA 93
|
| >d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 | Back information, alignment and structure |
|---|
| >d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 | Back information, alignment and structure |
|---|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 146 | |||
| d1lwma_ | 93 | NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T | 99.93 | |
| d1hsma_ | 79 | High mobility group protein 1, HMG1 {Hamster (Cric | 99.91 | |
| d1k99a_ | 91 | Nucleolar transcription factor 1 (Upstream binding | 99.91 | |
| d1gt0d_ | 80 | Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | 99.89 | |
| d1j46a_ | 85 | SRY {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1qrva_ | 73 | HMG-D {Drosophila melanogaster [TaxId: 7227]} | 99.88 | |
| d1i11a_ | 70 | Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | 99.88 | |
| d1ckta_ | 71 | High mobility group protein 1, HMG1 {Rat (Rattus n | 99.88 | |
| d1wgfa_ | 90 | Nucleolar transcription factor 1 (Upstream binding | 99.86 | |
| d1v64a_ | 108 | Nucleolar transcription factor 1 (Upstream binding | 99.86 | |
| d2lefa_ | 86 | Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus | 99.86 | |
| d1v63a_ | 101 | Nucleolar transcription factor 1 (Upstream binding | 99.84 | |
| d1l8ya_ | 84 | Nucleolar transcription factor 1 (Upstream binding | 97.17 |
| >d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HMG-box superfamily: HMG-box family: HMG-box domain: NHP6a species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.93 E-value=1.6e-25 Score=150.31 Aligned_cols=86 Identities=37% Similarity=0.670 Sum_probs=80.1
Q ss_pred cCccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhcCCChHhhHhHHHHHHHHHHHHHHHH
Q 032150 24 AGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDM 103 (146)
Q Consensus 24 ~~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~k~~Y~~e~ 103 (146)
.+++.+++.++|++||||+|||||||+++|..|+.+||+ +++.+|++.||.+|++||+++|.+|.++|..++.+|..+|
T Consensus 7 ~~k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~-~~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~ 85 (93)
T d1lwma_ 7 PKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPD-ITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEK 85 (93)
T ss_dssp TTSCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTT-SCHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCC-CcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHH
Confidence 344455566899999999999999999999999999999 9999999999999999999999999999999999999999
Q ss_pred HHhHHhc
Q 032150 104 KNYNRRQ 110 (146)
Q Consensus 104 ~~y~~k~ 110 (146)
..|+.++
T Consensus 86 ~~y~~~l 92 (93)
T d1lwma_ 86 ELYNATL 92 (93)
T ss_dssp HHHHHHH
T ss_pred HHHHhcc
Confidence 9999876
|
| >d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|