Citrus Sinensis ID: 032150


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPEEEEESEKSMSEVNDEDDDEEGSGEEDDDE
cccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccccccccccc
cccccccccHHHHHHccccccccccccccccccccccccccccHEEEEHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHccccccHccc
mkggksksdtrnaklsvnkkpakagrksgkaakdpnkpkrpasAFFVFMEEFREQykkdhpknksVAAVGKAggekwksmseadkapyvaKAEKRKVEYEKDMKNYnrrqaegtkpeeeeeseksmsevndedddeegsgeeddde
mkggksksdtrnaklsvnkkpakagrksgkaakdpnkpkrpASAFFVFMEEFREqykkdhpknksvAAVGkaggekwksmseadkapyvakaekrkveyekdmknynrrqaegtkpeeeeeseksmsevndedddeegsgeeddde
MKGGKSKSDTRNAKLSVNkkpakagrksgkaakDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPeeeeeseksmseVNdedddeegsgeeddde
********************************************FFVFME************************************************************************************************
****************************************PASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKD********************************************
***************************************RPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNR**************************************
***********************************NKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRR*************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYxxxxxxxxxxxxxxxxxxxxxQAEGTKPEEEEESEKSMSEVNDEDDDEEGSGEEDDDE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query146 2.2.26 [Sep-21-2011]
P93047141 High mobility group B pro no no 0.856 0.886 0.723 2e-45
O49596144 High mobility group B pro yes no 0.876 0.888 0.707 2e-45
P26585152 HMG1/2-like protein OS=Gl yes no 0.773 0.743 0.689 4e-37
P40619144 HMG1/2-like protein OS=Ip N/A no 0.904 0.916 0.639 2e-36
P40620149 HMG1/2-like protein OS=Vi N/A no 0.869 0.852 0.620 6e-33
Q42344138 High mobility group B pro no no 0.938 0.992 0.527 4e-32
O49595178 High mobility group B pro no no 0.732 0.601 0.626 5e-30
P27347157 DNA-binding protein MNB1B N/A no 0.773 0.719 0.625 5e-30
P40621161 HMG1/2-like protein OS=Tr N/A no 0.739 0.670 0.633 2e-25
O49597125 High mobility group B pro no no 0.678 0.792 0.474 1e-22
>sp|P93047|HMGB3_ARATH High mobility group B protein 3 OS=Arabidopsis thaliana GN=HMGB3 PE=1 SV=1 Back     alignment and function desciption
 Score =  180 bits (457), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 114/130 (87%), Gaps = 5/130 (3%)

Query: 1   MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDH 60
           MKG KSK++TR+ KLSV KKPAK  +    AAKDPNKPKRP+SAFFVFME+FR  YK++H
Sbjct: 1   MKGAKSKAETRSTKLSVTKKPAKGAKG---AAKDPNKPKRPSSAFFVFMEDFRVTYKEEH 57

Query: 61  PKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPEEEE 120
           PKNKSVAAVGKAGGEKWKS+S+++KAPYVAKA+KRKVEYEK+MK YN++  EG  P+E+E
Sbjct: 58  PKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLEEG--PKEDE 115

Query: 121 ESEKSMSEVN 130
           ES+KS+SEVN
Sbjct: 116 ESDKSVSEVN 125




Binds preferentially double-stranded DNA.
Arabidopsis thaliana (taxid: 3702)
>sp|O49596|HMGB2_ARATH High mobility group B protein 2 OS=Arabidopsis thaliana GN=HMGB2 PE=1 SV=1 Back     alignment and function description
>sp|P26585|HMGL_SOYBN HMG1/2-like protein OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|P40619|HMGL_IPONI HMG1/2-like protein OS=Ipomoea nil PE=2 SV=1 Back     alignment and function description
>sp|P40620|HMGL_VICFA HMG1/2-like protein OS=Vicia faba PE=2 SV=1 Back     alignment and function description
>sp|Q42344|HMGB4_ARATH High mobility group B protein 4 OS=Arabidopsis thaliana GN=HMGB4 PE=1 SV=1 Back     alignment and function description
>sp|O49595|HMGB1_ARATH High mobility group B protein 1 OS=Arabidopsis thaliana GN=HMGB1 PE=1 SV=1 Back     alignment and function description
>sp|P27347|MNB1B_MAIZE DNA-binding protein MNB1B OS=Zea mays GN=MNB1B PE=1 SV=1 Back     alignment and function description
>sp|P40621|HMGL_WHEAT HMG1/2-like protein OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|O49597|HMGB5_ARATH High mobility group B protein 5 OS=Arabidopsis thaliana GN=HMGB5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
297845042141 hypothetical protein ARALYDRAFT_472304 [ 0.931 0.964 0.765 4e-51
79318286142 high mobility group B2 protein [Arabidop 0.972 1.0 0.708 1e-48
8886929 662 F2D10.18 [Arabidopsis thaliana] 0.952 0.209 0.709 7e-48
145323962140 high mobility group B3 protein [Arabidop 0.931 0.971 0.723 2e-47
308569654146 high mobility group box 2 protein [Gossy 0.773 0.773 0.859 1e-46
312281681144 unnamed protein product [Thellungiella h 0.876 0.888 0.746 2e-46
312282031141 unnamed protein product [Thellungiella h 0.856 0.886 0.738 2e-45
308569660142 high mobility group box 1 protein [Gossy 0.863 0.887 0.838 5e-45
224083306160 high mobility group family [Populus tric 0.842 0.768 0.736 9e-45
18394900141 high mobility group B3 protein [Arabidop 0.856 0.886 0.723 1e-43
>gi|297845042|ref|XP_002890402.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] gi|297336244|gb|EFH66661.1| hypothetical protein ARALYDRAFT_472304 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 108/141 (76%), Positives = 127/141 (90%), Gaps = 5/141 (3%)

Query: 1   MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDH 60
           MKGGKSK++TRNAKLSV KKPAK G+    AAKDPNKPKRP+SAFFVFME+FRE YKK+H
Sbjct: 3   MKGGKSKTETRNAKLSVTKKPAKGGKG---AAKDPNKPKRPSSAFFVFMEDFRETYKKEH 59

Query: 61  PKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPEEEE 120
           PKNKSVAAVGKAGGEKWKS+S+++KAPYVAKA+KRKVEYEK+MK YN++  EG  P+E+E
Sbjct: 60  PKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLEEG--PKEDE 117

Query: 121 ESEKSMSEVNDEDDDEEGSGE 141
           ES+KS+SEVNDEDD E+GS E
Sbjct: 118 ESDKSVSEVNDEDDAEDGSEE 138




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|79318286|ref|NP_001031074.1| high mobility group B2 protein [Arabidopsis thaliana] gi|297845040|ref|XP_002890401.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. lyrata] gi|297336243|gb|EFH66660.1| hypothetical protein ARALYDRAFT_472301 [Arabidopsis lyrata subsp. lyrata] gi|332191886|gb|AEE30007.1| high mobility group B2 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|8886929|gb|AAF80615.1|AC069251_8 F2D10.18 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145323962|ref|NP_001077570.1| high mobility group B3 protein [Arabidopsis thaliana] gi|332191890|gb|AEE30011.1| high mobility group B3 protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|308569654|gb|ADO34793.1| high mobility group box 2 protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|312281681|dbj|BAJ33706.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|312282031|dbj|BAJ33881.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|308569660|gb|ADO34795.1| high mobility group box 1 protein [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|224083306|ref|XP_002306980.1| high mobility group family [Populus trichocarpa] gi|222856429|gb|EEE93976.1| high mobility group family [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18394900|ref|NP_564124.1| high mobility group B3 protein [Arabidopsis thaliana] gi|75220405|sp|P93047.1|HMGB3_ARATH RecName: Full=High mobility group B protein 3; AltName: Full=High mobility group protein B 2; Short=AtHMGbeta2; Short=HMG beta 2; AltName: Full=Nucleosome/chromatin assembly factor group D 03; Short=Nucleosome/chromatin assembly factor group D 3 gi|15724174|gb|AAL06479.1|AF411789_1 At1g20690/F2D10_15 [Arabidopsis thaliana] gi|1694976|emb|CAA70691.1| HMG1 [Arabidopsis thaliana] gi|2832361|emb|CAA74402.1| HMG protein [Arabidopsis thaliana] gi|20453325|gb|AAM19901.1| At1g20690/F2D10_15 [Arabidopsis thaliana] gi|21537072|gb|AAM61413.1| unknown [Arabidopsis thaliana] gi|22530942|gb|AAM96975.1| expressed protein [Arabidopsis thaliana] gi|23198424|gb|AAN15739.1| expressed protein [Arabidopsis thaliana] gi|332191888|gb|AEE30009.1| high mobility group B3 protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query146
TAIR|locus:505006135144 HMGB2 "high mobility group B2" 0.787 0.798 0.643 1.3e-36
TAIR|locus:2053893138 HMGB4 "high mobility group B4" 0.760 0.804 0.491 1.4e-25
TAIR|locus:2128003125 HMGB5 "high mobility group B5" 0.561 0.656 0.5 1e-20
MGI|MGI:1098219200 Hmgb3 "high mobility group box 0.554 0.405 0.457 4.8e-17
UNIPROTKB|F1RQ19202 LOC100517745 "Uncharacterized 0.554 0.400 0.445 4.8e-17
RGD|1564407200 Hmgb3 "high mobility group box 0.554 0.405 0.445 6e-17
UNIPROTKB|Q32L31200 HMGB3 "High mobility group pro 0.554 0.405 0.445 6e-17
UNIPROTKB|E7EQU1193 HMGB3 "High mobility group pro 0.554 0.419 0.433 6e-17
UNIPROTKB|E7ES08188 HMGB3 "High mobility group pro 0.554 0.430 0.433 6e-17
UNIPROTKB|O15347200 HMGB3 "High mobility group pro 0.554 0.405 0.433 6e-17
TAIR|locus:505006135 HMGB2 "high mobility group B2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 394 (143.8 bits), Expect = 1.3e-36, P = 1.3e-36
 Identities = 74/115 (64%), Positives = 91/115 (79%)

Query:     1 MKGGKSKSDTRNAKLSVNXXXXXXXXXXXXXXXDPNKPKRPASAFFVFMEEFREQYKKDH 60
             MKG KSK++TR++KLSV                DPNKPKRPASAFFVFME+FRE +KK++
Sbjct:     1 MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKEN 60

Query:    61 PKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTK 115
             PKNKSVA VGKA G+KWKS+S+++KAPYVAKAEKRKVEYEK++K YN++  EG K
Sbjct:    61 PKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPK 115




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0000785 "chromatin" evidence=TAS
GO:0003682 "chromatin binding" evidence=TAS
GO:0006333 "chromatin assembly or disassembly" evidence=RCA;TAS
GO:0030527 "structural constituent of chromatin" evidence=TAS
GO:0006096 "glycolysis" evidence=RCA
GO:0006833 "water transport" evidence=RCA
GO:0006972 "hyperosmotic response" evidence=RCA
GO:0007030 "Golgi organization" evidence=RCA
GO:0009266 "response to temperature stimulus" evidence=RCA
GO:0009651 "response to salt stress" evidence=RCA
GO:0046686 "response to cadmium ion" evidence=RCA
GO:0003677 "DNA binding" evidence=ISS;IDA
TAIR|locus:2053893 HMGB4 "high mobility group B4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128003 HMGB5 "high mobility group B5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1098219 Hmgb3 "high mobility group box 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQ19 LOC100517745 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1564407 Hmgb3 "high mobility group box 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32L31 HMGB3 "High mobility group protein B3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQU1 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E7ES08 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O15347 HMGB3 "High mobility group protein B3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O49596HMGB2_ARATHNo assigned EC number0.70760.87670.8888yesno
P40619HMGL_IPONINo assigned EC number0.63970.90410.9166N/Ano
P40620HMGL_VICFANo assigned EC number0.62040.86980.8523N/Ano
P93047HMGB3_ARATHNo assigned EC number0.72300.85610.8865nono
P26585HMGL_SOYBNNo assigned EC number0.68900.77390.7434yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.1__2258__AT1G20696.3
annotation not avaliable (141 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 3e-17
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 3e-15
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 9e-15
smart0039870 smart00398, HMG, high mobility group 6e-13
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 2e-08
PTZ0019994 PTZ00199, PTZ00199, high mobility group protein; P 2e-08
pfam0901169 pfam09011, DUF1898, Domain of unknown function (DU 1e-07
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 3e-07
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
 Score = 70.3 bits (173), Expect = 3e-17
 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 1/70 (1%)

Query: 38  PKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKV 97
           PKRP SAFF+F +E R + K ++P  K  A + K  GEKWK++SE +K PY  KAEK K 
Sbjct: 1   PKRPLSAFFLFSQEQRAKLKAENPGLK-NAEISKILGEKWKNLSEEEKKPYEEKAEKEKA 59

Query: 98  EYEKDMKNYN 107
            YEK    Y 
Sbjct: 60  RYEKAYPAYK 69


Length = 69

>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|185511 PTZ00199, PTZ00199, high mobility group protein; Provisional Back     alignment and domain information
>gnl|CDD|204115 pfam09011, DUF1898, Domain of unknown function (DUF1898) Back     alignment and domain information
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 146
PTZ0019994 high mobility group protein; Provisional 99.94
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.86
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.85
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.85
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.84
smart0039870 HMG high mobility group. 99.84
COG5648211 NHP6B Chromatin-associated proteins containing the 99.83
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.83
KOG038196 consensus HMG box-containing protein [General func 99.78
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.78
KOG0526615 consensus Nucleosome-binding factor SPN, POB3 subu 99.73
KOG0527 331 consensus HMG-box transcription factor [Transcript 99.72
KOG3248 421 consensus Transcription factor TCF-4 [Transcriptio 99.33
KOG4715 410 consensus SWI/SNF-related matrix-associated actin- 99.26
KOG0528511 consensus HMG-box transcription factor SOX5 [Trans 99.07
KOG2746 683 consensus HMG-box transcription factor Capicua and 98.68
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 98.47
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 97.81
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 97.61
COG5648211 NHP6B Chromatin-associated proteins containing the 97.23
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 97.04
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 95.59
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 95.47
TIGR03481198 HpnM hopanoid biosynthesis associated membrane pro 89.97
PRK15117211 ABC transporter periplasmic binding protein MlaC; 87.46
KOG3223221 consensus Uncharacterized conserved protein [Funct 85.67
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
Probab=99.94  E-value=2e-26  Score=157.77  Aligned_cols=89  Identities=44%  Similarity=0.696  Sum_probs=83.3

Q ss_pred             cCCCCccCccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCC--HHHHHHHHHHHhcCCChHhhHhHHHHHHHH
Q 032150           18 NKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKS--VAAVGKAGGEKWKSMSEADKAPYVAKAEKR   95 (146)
Q Consensus        18 ~k~~~~~~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~--~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~   95 (146)
                      ++.+.+.+++++++.+||++||||+|||||||+++|..|..+||+ ++  +++|+++||++|+.||+++|.+|.++|..+
T Consensus         3 ~~~~~~~~k~~~k~~kdp~~PKrP~sAY~~F~~~~R~~i~~~~P~-~~~~~~evsk~ige~Wk~ls~eeK~~y~~~A~~d   81 (94)
T PTZ00199          3 KKQGKVLVRKNKRKKKDPNAPKRALSAYMFFAKEKRAEIIAENPE-LAKDVAAVGKMVGEAWNKLSEEEKAPYEKKAQED   81 (94)
T ss_pred             ccccCccccccCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCcC-CcccHHHHHHHHHHHHHcCCHHHHHHHHHHHHHH
Confidence            356777778888889999999999999999999999999999999 64  899999999999999999999999999999


Q ss_pred             HHHHHHHHHHhH
Q 032150           96 KVEYEKDMKNYN  107 (146)
Q Consensus        96 k~~Y~~e~~~y~  107 (146)
                      +.+|..+|..|+
T Consensus        82 k~rY~~e~~~Y~   93 (94)
T PTZ00199         82 KVRYEKEKAEYA   93 (94)
T ss_pred             HHHHHHHHHHHh
Confidence            999999999996



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG0381 consensus HMG box-containing protein [General function prediction only] Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>KOG0526 consensus Nucleosome-binding factor SPN, POB3 subunit [Transcription; Replication, recombination and repair; Chromatin structure and dynamics] Back     alignment and domain information
>KOG0527 consensus HMG-box transcription factor [Transcription] Back     alignment and domain information
>KOG3248 consensus Transcription factor TCF-4 [Transcription] Back     alignment and domain information
>KOG4715 consensus SWI/SNF-related matrix-associated actin-dependent regulator of chromatin [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0528 consensus HMG-box transcription factor SOX5 [Transcription] Back     alignment and domain information
>KOG2746 consensus HMG-box transcription factor Capicua and related proteins [Transcription] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR03481 HpnM hopanoid biosynthesis associated membrane protein HpnM Back     alignment and domain information
>PRK15117 ABC transporter periplasmic binding protein MlaC; Provisional Back     alignment and domain information
>KOG3223 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1j3c_A79 Solution Structure Of The C-Terminal Domain Of The 2e-12
2yqi_A81 Solution Structure Of The Second Hmg-Box Domain Fro 4e-12
1j3d_A78 Solution Structure Of The C-Terminal Domain Of The 4e-12
1hme_A77 Structure Of The Hmg Box Motif In The B-Domain Of H 4e-11
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 6e-11
2yrq_A173 Solution Structure Of The Tandem Hmg Box Domain Fro 7e-11
1nhm_A81 The Structure Of The Hmg Box And Its Interaction Wi 9e-10
1hsm_A79 The Structure Of The Hmg Box And Its Interaction Wi 4e-09
1j5n_A93 Solution Structure Of The Non-Sequence-Specific Hmg 6e-09
1cg7_A93 Hmg Protein Nhp6a From Saccharomyces Cerevisiae Len 7e-09
2lhj_A97 Nmr Structure Of The High Mobility Group Protein-Li 6e-08
1qrv_A73 Crystal Structure Of The Complex Of Hmg-D And Dna L 2e-07
1e7j_A74 Hmg-D Complexed To A Bulge Dna Length = 74 2e-07
1hma_A73 The Solution Structure And Dynamics Of The Dna Bind 2e-07
1j3x_A77 Solution Structure Of The N-Terminal Domain Of The 3e-07
3nm9_A73 Hmgd(M13a)-Dna Complex Length = 73 3e-07
2ly4_A83 Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-Bo 2e-06
1wxl_A73 Solution Structure Of The Hmg-Box Domain In The Ssr 4e-06
1aab_A83 Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 4e-06
4euw_A106 Crystal Structure Of A Hmg Domain Of Transcription 6e-06
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 7e-06
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 7e-06
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 7e-06
2crj_A92 Solution Structure Of The Hmg Domain Of Mouse Hmg D 1e-05
1ckt_A71 Crystal Structure Of Hmg1 Domain A Bound To A Cispl 6e-05
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 8e-05
3tq6_A214 Crystal Structure Of Human Mitochondrial Transcript 9e-05
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 1e-04
3fgh_A67 Human Mitochondrial Transcription Factor A Box B Le 1e-04
2e6o_A87 Solution Structure Of The Hmg Box Domain From Human 2e-04
1wgf_A90 Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 2e-04
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 4e-04
1hrz_A76 The 3d Structure Of The Human Sry-Dna Complex Solve 4e-04
1k99_A99 Solution Structure Of The First Hmg Box In Human Up 4e-04
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 4e-04
3tmm_A238 Tfam Imposes A U-Turn On Mitochondrial Dna Length = 5e-04
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 6e-04
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 6e-04
2eqz_A86 Solution Structure Of The First Hmg-Box Domain From 7e-04
>pdb|1J3C|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 79 Back     alignment and structure

Iteration: 1

Score = 68.2 bits (165), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 36/73 (49%), Positives = 43/73 (58%), Gaps = 1/73 (1%) Query: 34 DPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAE 93 DPN PKRP SAFF+F E+R + K +HP S+ K GE W S DK PY KA Sbjct: 5 DPNAPKRPPSAFFLFCSEYRPKIKSEHP-GLSIGDTAKKLGEMWSEQSAKDKQPYEQKAA 63 Query: 94 KRKVEYEKDMKNY 106 K K +YEKD+ Y Sbjct: 64 KLKEKYEKDIAAY 76
>pdb|2YQI|A Chain A, Solution Structure Of The Second Hmg-Box Domain From High Mobility Group Protein B3 Length = 81 Back     alignment and structure
>pdb|1J3D|A Chain A, Solution Structure Of The C-Terminal Domain Of The Hmgb2 Length = 78 Back     alignment and structure
>pdb|1HME|A Chain A, Structure Of The Hmg Box Motif In The B-Domain Of Hmg1 Length = 77 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|2YRQ|A Chain A, Solution Structure Of The Tandem Hmg Box Domain From Human High Mobility Group Protein B1 Length = 173 Back     alignment and structure
>pdb|1NHM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 81 Back     alignment and structure
>pdb|1HSM|A Chain A, The Structure Of The Hmg Box And Its Interaction With Dna Length = 79 Back     alignment and structure
>pdb|1J5N|A Chain A, Solution Structure Of The Non-Sequence-Specific Hmgb Protein Nhp6a In Complex With Sry Dna Length = 93 Back     alignment and structure
>pdb|1CG7|A Chain A, Hmg Protein Nhp6a From Saccharomyces Cerevisiae Length = 93 Back     alignment and structure
>pdb|2LHJ|A Chain A, Nmr Structure Of The High Mobility Group Protein-Like Protein Nhp1 From Babesia Bovis T2bo (Baboa.00841.A) Length = 97 Back     alignment and structure
>pdb|1QRV|A Chain A, Crystal Structure Of The Complex Of Hmg-D And Dna Length = 73 Back     alignment and structure
>pdb|1E7J|A Chain A, Hmg-D Complexed To A Bulge Dna Length = 74 Back     alignment and structure
>pdb|1HMA|A Chain A, The Solution Structure And Dynamics Of The Dna Binding Domain Of Hmg-D From Drosophila Melanogaster Length = 73 Back     alignment and structure
>pdb|1J3X|A Chain A, Solution Structure Of The N-Terminal Domain Of The Hmgb2 Length = 77 Back     alignment and structure
>pdb|3NM9|A Chain A, Hmgd(M13a)-Dna Complex Length = 73 Back     alignment and structure
>pdb|2LY4|A Chain A, Hmgb1-Facilitated P53 Dna Binding Occurs Via Hmg-BoxP53 Transactivation Domain Interaction And Is Regulated By The Acidic Tail Length = 83 Back     alignment and structure
>pdb|1WXL|A Chain A, Solution Structure Of The Hmg-Box Domain In The Ssrp1 Subunit Of Fact Length = 73 Back     alignment and structure
>pdb|1AAB|A Chain A, Nmr Structure Of Rat Hmg1 Hmga Fragment Length = 83 Back     alignment and structure
>pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure
>pdb|2CRJ|A Chain A, Solution Structure Of The Hmg Domain Of Mouse Hmg Domain Protein Hmgx2 Length = 92 Back     alignment and structure
>pdb|1CKT|A Chain A, Crystal Structure Of Hmg1 Domain A Bound To A Cisplatin-modified Dna Duplex Length = 71 Back     alignment and structure
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure
>pdb|3TQ6|A Chain A, Crystal Structure Of Human Mitochondrial Transcription Factor A, Tfam Or Mttfa, Bound To The Light Strand Promoter Lsp Length = 214 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|3FGH|A Chain A, Human Mitochondrial Transcription Factor A Box B Length = 67 Back     alignment and structure
>pdb|2E6O|A Chain A, Solution Structure Of The Hmg Box Domain From Human Hmg-Box Transcription Factor 1 Length = 87 Back     alignment and structure
>pdb|1WGF|A Chain A, Solution Structure Of The 4th Hmg-Box Of Mouse Ubf1 Length = 90 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 Back     alignment and structure
>pdb|1K99|A Chain A, Solution Structure Of The First Hmg Box In Human Upstream Binding Factor Length = 99 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|3TMM|A Chain A, Tfam Imposes A U-Turn On Mitochondrial Dna Length = 238 Back     alignment and structure
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure
>pdb|2EQZ|A Chain A, Solution Structure Of The First Hmg-Box Domain From High Mobility Group Protein B3 Length = 86 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query146
1hme_A77 High mobility group protein fragment-B; DNA-bindin 6e-23
2lhj_A97 High mobility group protein homolog NHP1; structur 6e-22
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 8e-22
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 1e-21
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 5e-21
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 6e-21
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 9e-21
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 2e-19
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 9e-18
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 1e-17
1ckt_A71 High mobility group 1 protein; high-mobility group 1e-17
1wgf_A90 Upstream binding factor 1; transcription factor, D 1e-17
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 2e-16
2yrq_A173 High mobility group protein B1; HMG box domain, DN 3e-16
2yrq_A173 High mobility group protein B1; HMG box domain, DN 2e-11
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 8e-16
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 4e-14
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 3e-13
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 6e-13
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 1e-12
3tq6_A214 Transcription factor A, mitochondrial; transcripti 8e-12
3tq6_A214 Transcription factor A, mitochondrial; transcripti 2e-09
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 7e-11
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 1e-10
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 4e-10
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 8e-09
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 1e-09
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 6e-09
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 7e-09
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 1e-08
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 2e-08
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 2e-08
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 6e-08
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 3e-06
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 4e-06
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 1e-05
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
 Score = 85.0 bits (211), Expect = 6e-23
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%)

Query: 33  KDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKA 92
           KDPN PKRP SAFF+F  E+R + K +HP   S+  V K  GE W + +  DK PY  KA
Sbjct: 2   KDPNAPKRPPSAFFLFCSEYRPKIKGEHP-GLSIGDVAKKLGEMWNNTAADDKQPYEKKA 60

Query: 93  EKRKVEYEKDMKNYNRR 109
            K K +YEKD+  Y  +
Sbjct: 61  AKLKEKYEKDIAAYRAK 77


>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.94
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.93
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.93
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.92
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.92
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.92
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.92
2lhj_A97 High mobility group protein homolog NHP1; structur 99.92
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.92
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.92
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.91
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.91
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.91
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.9
1ckt_A71 High mobility group 1 protein; high-mobility group 99.9
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.9
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.89
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.89
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.89
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.89
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.89
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.89
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.89
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.89
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.88
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.88
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.88
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.88
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.87
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.86
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.86
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.85
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.83
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.83
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.81
2cto_A93 Novel protein; high mobility group box domain, hel 99.81
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.8
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.79
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.75
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
Probab=99.94  E-value=7.9e-27  Score=160.75  Aligned_cols=90  Identities=28%  Similarity=0.493  Sum_probs=83.6

Q ss_pred             CccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhcCCChHhhHhHHHHHHHHHHHHHHHHH
Q 032150           25 GRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMK  104 (146)
Q Consensus        25 ~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~k~~Y~~e~~  104 (146)
                      ..+++++.+||++||||+|||||||+++|..|+.+||+ +++.+|+++||++|++|++++|++|.++|..++++|..+|.
T Consensus         5 ~~~~kk~~kdp~~pKrP~say~lF~~~~r~~i~~~~P~-~~~~eisk~lg~~Wk~ls~eeK~~Y~~~A~~~k~~y~~e~~   83 (102)
T 2co9_A            5 SSGKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPN-ATFGEVSKIVASMWDGLGEEQKQVYKKKTEAAKKEYLKQLA   83 (102)
T ss_dssp             CCCSCSSCCCCCSCCCCCCHHHHTHHHHHHHHHHHCTT-SCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34445677899999999999999999999999999999 99999999999999999999999999999999999999999


Q ss_pred             HhHHhcCCCCC
Q 032150          105 NYNRRQAEGTK  115 (146)
Q Consensus       105 ~y~~k~~~~~~  115 (146)
                      .|+.++.....
T Consensus        84 ~Y~~~~~~~~~   94 (102)
T 2co9_A           84 AYRASLVSKSY   94 (102)
T ss_dssp             HHHHHHTSSCC
T ss_pred             HHHhhcccccc
Confidence            99999876554



>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 146
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 2e-15
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-13
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 8e-13
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 1e-12
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 2e-12
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-12
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 5e-12
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 8e-12
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 3e-11
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 2e-10
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-09
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-07
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 64.9 bits (158), Expect = 2e-15
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 1/93 (1%)

Query: 19  KKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWK 78
             P +  +++ +  KDPN PKR  SA+  F  E R+  + ++P + +   VGK  GEKWK
Sbjct: 2   VTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENP-DITFGQVGKKLGEKWK 60

Query: 79  SMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQA 111
           +++  +K PY AKA+  K  YE + + YN   A
Sbjct: 61  ALTPEEKQPYEAKAQADKKRYESEKELYNATLA 93


>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query146
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.93
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.91
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.91
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.88
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.88
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.86
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.86
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.86
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.84
d1l8ya_84 Nucleolar transcription factor 1 (Upstream binding 97.17
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.93  E-value=1.6e-25  Score=150.31  Aligned_cols=86  Identities=37%  Similarity=0.670  Sum_probs=80.1

Q ss_pred             cCccCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHhcCCChHhhHhHHHHHHHHHHHHHHHH
Q 032150           24 AGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDM  103 (146)
Q Consensus        24 ~~kk~~k~~~dp~~PKrP~say~lF~~e~r~~~~~~~p~~~~~~ei~k~l~~~Wk~ls~~eK~~y~~~A~~~k~~Y~~e~  103 (146)
                      .+++.+++.++|++||||+|||||||+++|..|+.+||+ +++.+|++.||.+|++||+++|.+|.++|..++.+|..+|
T Consensus         7 ~~k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~-~~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~~y~~e~   85 (93)
T d1lwma_           7 PKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPD-ITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEK   85 (93)
T ss_dssp             TTSCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTT-SCHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCC-CcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHH
Confidence            344455566899999999999999999999999999999 9999999999999999999999999999999999999999


Q ss_pred             HHhHHhc
Q 032150          104 KNYNRRQ  110 (146)
Q Consensus       104 ~~y~~k~  110 (146)
                      ..|+.++
T Consensus        86 ~~y~~~l   92 (93)
T d1lwma_          86 ELYNATL   92 (93)
T ss_dssp             HHHHHHH
T ss_pred             HHHHhcc
Confidence            9999876



>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l8ya_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure