Citrus Sinensis ID: 032169


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140------
MAPLTANDLQRIFEKLDRNGDGLVSLEELNWVLERIGVHFTLEELEALVEKPSLCFDEFLFFCDSIISNNNNNNPNAAADASQNADEAVDDDSGDEEISDLYKAFSVFDVNGDGFITSEELQSVLARLGLWDEEKQPRLQKHDLRV
ccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHcccccccccccHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccccHHHHHHHHcccccc
MAPLTANDLQRIFEKLDRNGDGLVSLEELNWVLERIGVHFTLEELEALVEKPSLCFDEFLFFCDSIISNNNNNNPNAAADA*****************SDLYKAFSVFDVNGDGFITSEELQSVLARLGLWDEEKQPRLQKHDLR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPLTANDLQRIFEKLDRNGDGLVSLEELNWVLERIGVHFTLEELEALVEKPSLCFDEFLFFCDSIISNNNNNNPNAAADASQNADEAVDDDSGDEEISDLYKAFSVFDVNGDGFITSEELQSVLARLGLWDEEKQPRLQKHDLRV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable calcium-binding protein CML44 Potential calcium sensor.probableQ9LPK5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 2-69,89-145
View the alignment between query and template
View the model in PyMOL
Template: 1QXP, chain A
Confidence level:confident
Coverage over the Query: 6-90,105-144
View the alignment between query and template
View the model in PyMOL