Citrus Sinensis ID: 032189

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MPKVKTNRVKIPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFKIAHQKSRYIFDLYYRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCMQPRDHNFQTTCVCRVPKNLREEKVIECVHCGCRGCASGD
ccccccccccccccHHcHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHcccccHHHHHHccccccCEEccccccccccccccccEEEEcccccccccEEEccccccccccccc
***********PEGWELIEPTLRE*****************KCETLWPIFKIAHQKSRYIFDLYYRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCMQPRDHNFQTTCVCRVPKNLREEKVIECVHCGCRGCA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPKVKTNRVKIPEGWELIEPTLRELQAKMREAENDPHDGKRKCETLWPIFKIAHQKSRYIFDLYYRRKEISKELYEFCLDQGYADRNLIAKWKKPGYERLCCLRCMQPRDHNFQTTCVCRVPKNLREEKVIECVHCGCRGCASGD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BUD31 homolog 2 confidentQ65WT0
Pre-mRNA-splicing factor cwf14 Involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome.probableO74772
Protein BUD31 homolog probableP41223

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted