Query         032201
Match_columns 145
No_of_seqs    89 out of 91
Neff          2.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:57:52 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032201.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032201hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05922 Inhibitor_I9:  Peptida  91.4    0.28   6E-06   32.1   3.3   61   80-145     2-67  (82)
  2 PF12674 Zn_ribbon_2:  Putative  60.5      12 0.00027   26.6   3.3   29   91-119    41-70  (81)
  3 TIGR03868 F420-O_ABCperi propo  53.2      16 0.00035   28.9   3.1   26   93-119   126-151 (287)
  4 cd01143 YvrC Periplasmic bindi  47.1      19 0.00042   26.4   2.5   22   98-119    97-118 (195)
  5 cd01148 TroA_a Metal binding p  46.1      30 0.00065   27.3   3.7   25   92-117   123-147 (284)
  6 COG0614 FepB ABC-type Fe3+-hyd  45.8      15 0.00033   28.9   1.9   23   98-120   151-173 (319)
  7 cd01144 BtuF Cobalamin binding  45.0      16 0.00034   28.1   1.8   25   94-119    91-115 (245)
  8 KOG1276 Protoporphyrinogen oxi  44.0      19 0.00041   33.9   2.6   45   65-116   382-427 (491)
  9 PF10847 DUF2656:  Protein of u  44.0      38 0.00083   27.0   3.9   30   76-109    41-70  (132)
 10 PF01497 Peripla_BP_2:  Peripla  42.5      61  0.0013   24.3   4.7   23   96-118    96-118 (238)
 11 cd01139 TroA_f Periplasmic bin  41.8      44 0.00096   27.3   4.1   25   93-118   130-154 (342)
 12 PRK10576 iron-hydroxamate tran  41.7      28 0.00061   28.3   3.0   24   94-117   127-150 (292)
 13 PF13961 DUF4219:  Domain of un  40.7     1.8 3.9E-05   25.1  -3.0   14   72-85      1-14  (27)
 14 cd01147 HemV-2 Metal binding p  39.5      32  0.0007   26.5   2.8   21   98-118   113-133 (262)
 15 PRK11411 fecB iron-dicitrate t  37.6      38 0.00082   27.5   3.1   26   93-119   134-159 (303)
 16 cd01146 FhuD Fe3+-siderophore   37.4      60  0.0013   25.2   4.1   25   93-118    97-121 (256)
 17 KOG1412 Aspartate aminotransfe  37.4      46 0.00099   30.7   3.8   53   62-132   173-225 (410)
 18 cd01149 HutB Hemin binding pro  35.1      47   0.001   25.6   3.1   21   98-118    96-116 (235)
 19 KOG4079 Putative mitochondrial  35.0      25 0.00055   28.8   1.7   40   91-133    93-135 (169)
 20 TIGR03659 IsdE heme ABC transp  34.4      43 0.00094   27.0   3.0   22   96-117   125-146 (289)
 21 cd01142 TroA_e Periplasmic bin  33.0      47   0.001   26.3   2.9   22   98-119   123-144 (289)
 22 COG1448 TyrB Aspartate/tyrosin  32.4      59  0.0013   30.0   3.7   57   64-138   169-225 (396)
 23 cd01140 FatB Siderophore bindi  32.2      50  0.0011   25.8   2.9   20   98-117   109-128 (270)
 24 PRK03379 vitamin B12-transport  31.3      44 0.00096   26.7   2.5   24   93-117   105-128 (260)
 25 COG4607 CeuA ABC-type enteroch  30.1      33 0.00072   30.8   1.7   21  101-121   158-178 (320)
 26 PRK11630 hypothetical protein;  30.0      33 0.00072   27.5   1.6   36  102-142    17-53  (206)
 27 KOG1670 Translation initiation  27.6      99  0.0021   26.4   4.1   28   79-111   110-137 (212)
 28 cd00636 TroA-like Helical back  26.7      70  0.0015   21.1   2.5   24   96-119    98-121 (148)
 29 KOG1257 NADP+-dependent malic   25.8      65  0.0014   31.1   2.9   24  101-125   329-353 (582)
 30 PRK10957 iron-enterobactin tra  25.2      67  0.0014   26.1   2.6   17  101-117   153-169 (317)
 31 cd01851 GBP Guanylate-binding   25.1      92   0.002   24.9   3.3   32   78-109    59-91  (224)
 32 TIGR00013 taut 4-oxalocrotonat  25.0      63  0.0014   20.3   1.9   44   91-134    14-57  (63)
 33 PF08006 DUF1700:  Protein of u  24.9      96  0.0021   23.9   3.3   26   90-115    18-46  (181)
 34 KOG0578 p21-activated serine/t  24.5      26 0.00055   33.4   0.1   18  122-140   408-425 (550)
 35 PF01026 TatD_DNase:  TatD rela  24.3 1.1E+02  0.0023   24.6   3.6   51   71-121   191-248 (255)
 36 cd01138 FeuA Periplasmic bindi  24.2      80  0.0017   24.4   2.7   19   99-117   100-118 (248)
 37 PRK14048 ferrichrome/ferrioxam  24.1      73  0.0016   26.8   2.7   20  100-119   166-185 (374)
 38 PF04970 LRAT:  Lecithin retino  23.8      41 0.00088   24.3   1.0   22   64-85      7-28  (125)
 39 PRK02260 S-ribosylhomocysteina  23.6      99  0.0021   25.0   3.2   31   74-109    81-111 (158)
 40 PF01282 Ribosomal_S24e:  Ribos  23.3 1.6E+02  0.0036   20.9   4.0   42   82-130     3-44  (84)
 41 cd00954 NAL N-Acetylneuraminic  22.9 1.8E+02  0.0038   24.0   4.7   50   87-144   105-154 (288)
 42 PRK02220 4-oxalocrotonate taut  22.6 1.1E+02  0.0024   19.1   2.8   43   90-132    13-55  (61)
 43 cd00491 4Oxalocrotonate_Tautom  22.3      90  0.0019   19.1   2.2   41   91-131    13-53  (58)
 44 PF07105 DUF1367:  Protein of u  21.7   1E+02  0.0022   25.9   3.0   36   71-112    53-90  (196)
 45 PF14581 SseB_C:  SseB protein   21.6 1.9E+02  0.0041   20.3   4.1   34   74-110    45-78  (108)
 46 TIGR00683 nanA N-acetylneurami  21.1   2E+02  0.0043   24.0   4.6   59   76-144    96-154 (290)
 47 PF01876 RNase_P_p30:  RNase P   21.1      80  0.0017   23.6   2.1   17  103-119   130-147 (150)
 48 PF02664 LuxS:  S-Ribosylhomocy  21.0 2.1E+02  0.0046   23.2   4.6   34   74-112    81-114 (157)
 49 COG1854 LuxS LuxS protein invo  20.9 1.8E+02   0.004   23.9   4.3   82   12-110    22-112 (161)
 50 PF08776 VASP_tetra:  VASP tetr  20.7 1.2E+02  0.0025   19.9   2.5   15   94-108    24-38  (40)
 51 PF08947 BPS:  BPS (Between PH   20.6      49  0.0011   22.5   0.8   10   80-89      7-16  (49)
 52 PLN02150 terpene synthase/cycl  20.4      49  0.0011   23.9   0.9   20   98-121    10-30  (96)
 53 PRK08187 pyruvate kinase; Vali  20.3      99  0.0021   28.8   3.0   30   89-118   434-482 (493)

No 1  
>PF05922 Inhibitor_I9:  Peptidase inhibitor I9;  InterPro: IPR010259 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  Limited proteolysis of most large protein precursors is carried out in vivo by the subtilisin-like pro-protein convertases. Many important biological processes such as peptide hormone synthesis, viral protein processing and receptor maturation involve proteolytic processing by these enzymes []. The subtilisin-serine protease (SRSP) family hormone and pro-protein convertases (furin, PC1/3, PC2, PC4, PACE4, PC5/6, and PC7/7/LPC) act within the secretory pathway to cleave polypeptide precursors at specific basic sites, generating their biologically active forms. Serum proteins, pro-hormones, receptors, zymogens, viral surface glycoproteins, bacterial toxins, amongst others, are activated by this route []. The SRSPs share the same domain structure, including a signal peptide, the pro-peptide, the catalytic domain, the P/middle or homo B domain, and the C terminus. Proteinase propeptide inhibitors (sometimes refered to as activation peptides) are responsible for the modulation of folding and activity of the pro-enzyme or zymogen. The pro-segment docks into the enzyme moiety shielding the substrate binding site, thereby promoting inhibition of the enzyme. Several such propeptides share a similar topology [], despite often low sequence identities []. The propeptide region has an open-sandwich antiparallel-alpha/antiparallel-beta fold, with two alpha-helices and four beta-strands with a (beta/alpha/beta)x2 topology. This group of sequences contain the propeptide domain at the N terminus of peptidases belonging to MEROPS family S8A, subtilisins. A number of the members of this group of sequences belong to MEROPS inhibitor family I9, clan I-. The propeptide is removed by proteolytic cleavage; removal activating the enzyme.; GO: 0004252 serine-type endopeptidase activity, 0042802 identical protein binding, 0043086 negative regulation of catalytic activity; PDB: 3CNQ_P 1SPB_P 3CO0_P 1ITP_A 1V5I_B 1SCJ_B 3P5B_P 2XTJ_P 2W2M_P 2P4E_P ....
Probab=91.40  E-value=0.28  Score=32.08  Aligned_cols=61  Identities=20%  Similarity=0.394  Sum_probs=35.5

Q ss_pred             eEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCCH----HHHhcc-cceeeecceeeeeeeeCHHHHhhhhCC
Q 032201           80 WLIVMEFPKDPAPTREQMIETYLNTLATVLGSM----EEAKKN-MYAFSTTTYTGFQCTVSEETSEKFKGV  145 (145)
Q Consensus        80 WLVvMe~P~~~~psr~emId~Yv~TLAkVLGSE----EEAKkk-IYsvSt~tyfGF~c~I~EE~S~klk~l  145 (145)
                      .+|+|+.+.    +.++..+...+-++..+.+-    ...+-+ +|.+.. .--||.+.++++..++|+..
T Consensus         2 YIV~~k~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~~-~~~Gfs~~l~~~~i~~L~~~   67 (82)
T PF05922_consen    2 YIVVFKDDA----SAASSFSSHKSWQASILKSALKSASSINAKVLYSYDN-AFNGFSAKLSEEEIEKLRKD   67 (82)
T ss_dssp             EEEEE-TTS----THHCHHHHHHHHHH----HHHHTH-TTT-EEEEEESS-TSSEEEEEE-HHHHHHHHTS
T ss_pred             EEEEECCCC----CcchhHHHHHHHHHHHHhhhhhhhcccCCceEEEEee-eEEEEEEEeCHHHHHHHHcC
Confidence            478888663    33334556666666555432    122333 676766 78999999999999999863


No 2  
>PF12674 Zn_ribbon_2:  Putative zinc ribbon domain
Probab=60.46  E-value=12  Score=26.64  Aligned_cols=29  Identities=38%  Similarity=0.391  Sum_probs=25.4

Q ss_pred             CCCHHHHHHHHHHHHHHHhC-CHHHHhccc
Q 032201           91 APTREQMIETYLNTLATVLG-SMEEAKKNM  119 (145)
Q Consensus        91 ~psr~emId~Yv~TLAkVLG-SEEEAKkkI  119 (145)
                      +-|.+|||+.-++-+++.-| ++|||++-+
T Consensus        41 ~~t~eemie~~~~~~~~~~~~~~~~a~~~~   70 (81)
T PF12674_consen   41 DITMEEMIEFCVPFMDEFNGMTPEEARKMM   70 (81)
T ss_pred             cCCHHHHHHHHHHHHHHhCCCCHHHHHHHH
Confidence            56899999999999999987 899998753


No 3  
>TIGR03868 F420-O_ABCperi proposed F420-0 ABC transporter, periplasmic F420-0 binding protein. This small clade of ABC-type transporter periplasmic binding protein components is found as a three gene cassette along with a permease (TIGR03869) and an ATPase (TIGR03873). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this periplasmic binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=53.20  E-value=16  Score=28.93  Aligned_cols=26  Identities=12%  Similarity=0.240  Sum_probs=19.6

Q ss_pred             CHHHHHHHHHHHHHHHhCCHHHHhccc
Q 032201           93 TREQMIETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        93 sr~emId~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      +.+++.+. ++.||+++|.||+|++-|
T Consensus       126 ~~~~~~~~-i~~lg~~~g~e~~A~~~i  151 (287)
T TIGR03868       126 TFDDVFAE-ITEVGTIFDVPDAAASLV  151 (287)
T ss_pred             CHHHHHHH-HHHHHHHhCCHHHHHHHH
Confidence            45555554 789999999999987643


No 4  
>cd01143 YvrC Periplasmic binding protein YvrC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria and archaea.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=47.13  E-value=19  Score=26.38  Aligned_cols=22  Identities=27%  Similarity=0.388  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHhCCHHHHhccc
Q 032201           98 IETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      +.-.++.|++++|-+|+|++-|
T Consensus        97 ~~~~~~~lg~~~g~~~~a~~~~  118 (195)
T cd01143          97 IYDQIELIGKITGAEEEAEKLV  118 (195)
T ss_pred             HHHHHHHHHHHhCChHHHHHHH
Confidence            3346889999999999887743


No 5  
>cd01148 TroA_a Metal binding protein TroA_a.  These proteins are predicted to function as initial receptors in ABC transport of metal ions in eubacteria. They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=46.10  E-value=30  Score=27.34  Aligned_cols=25  Identities=16%  Similarity=0.306  Sum_probs=18.4

Q ss_pred             CCHHHHHHHHHHHHHHHhCCHHHHhc
Q 032201           92 PTREQMIETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        92 psr~emId~Yv~TLAkVLGSEEEAKk  117 (145)
                      .+.+++.+ .++.+++++|.||+|++
T Consensus       123 ~~~~~~~~-~~~~lg~~~g~e~~A~~  147 (284)
T cd01148         123 ATLDDVYN-DIRNLGKIFDVEDRADK  147 (284)
T ss_pred             CCHHHHHH-HHHHHHHHhCCHhHHHH
Confidence            34555555 68889999999888765


No 6  
>COG0614 FepB ABC-type Fe3+-hydroxamate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=45.78  E-value=15  Score=28.91  Aligned_cols=23  Identities=26%  Similarity=0.371  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHHhCCHHHHhcccc
Q 032201           98 IETYLNTLATVLGSMEEAKKNMY  120 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKkkIY  120 (145)
                      +.--++++|+++|.|++|++-|-
T Consensus       151 ~~~~i~~lg~~~g~e~~A~~li~  173 (319)
T COG0614         151 IKEQIRLLGKALGKEEKAEELIA  173 (319)
T ss_pred             HHHHHHHHHHHhCcHHHHHHHHH
Confidence            44567899999999999987553


No 7  
>cd01144 BtuF Cobalamin binding protein BtuF.  These proteins have been shown to function as initial receptors in ABC transport of vitamin B12 (cobalamin) in eubacterial and some archaeal species.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=45.01  E-value=16  Score=28.14  Aligned_cols=25  Identities=16%  Similarity=0.275  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHhCCHHHHhccc
Q 032201           94 REQMIETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        94 r~emId~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      .+++. -.+++||+++|.+|+|++.+
T Consensus        91 ~~~~~-~~~~~lg~~~g~~~~a~~~~  115 (245)
T cd01144          91 LDDIL-ADIRRLGTLAGRPARAEELA  115 (245)
T ss_pred             HHHHH-HHHHHHHHHhCChhHHHHHH
Confidence            34433 46899999999999996543


No 8  
>KOG1276 consensus Protoporphyrinogen oxidase [Coenzyme transport and metabolism]
Probab=44.04  E-value=19  Score=33.91  Aligned_cols=45  Identities=22%  Similarity=0.437  Sum_probs=36.4

Q ss_pred             CCCcccccCCCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhC-CHHHHh
Q 032201           65 EPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLG-SMEEAK  116 (145)
Q Consensus        65 ~~~~tiLf~GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLG-SEEEAK  116 (145)
                      .++-|.+.-||-+.||-+       -.+|++|.++.--+-|.+-|| ++|++.
T Consensus       382 s~~vtvm~gg~~~~n~~~-------~~~S~ee~~~~v~~alq~~Lgi~~~P~~  427 (491)
T KOG1276|consen  382 SPKVTVMMGGGGSTNTSL-------AVPSPEELVNAVTSALQKMLGISNKPVS  427 (491)
T ss_pred             CceEEEEecccccccCcC-------CCCCHHHHHHHHHHHHHHHhCCCCCccc
Confidence            447777888888887754       478999999999999999999 666653


No 9  
>PF10847 DUF2656:  Protein of unknown function (DUF2656);  InterPro: IPR020325 This entry contains uncharacterised proteins from the cpeY 3'-region. They have no known function, but are found in the phycobilisome.
Probab=44.03  E-value=38  Score=26.99  Aligned_cols=30  Identities=17%  Similarity=0.418  Sum_probs=25.8

Q ss_pred             CCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHh
Q 032201           76 DYNHWLIVMEFPKDPAPTREQMIETYLNTLATVL  109 (145)
Q Consensus        76 Dy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVL  109 (145)
                      +--||||-++    ..-+++||-...++++.+.=
T Consensus        41 ~hPHW~v~i~----s~lsp~~~~~~~v~aw~~~R   70 (132)
T PF10847_consen   41 NHPHWMVEIE----SDLSPDEMAEELVRAWKQYR   70 (132)
T ss_pred             cCCceEEEec----ccCCHHHHHHHHHHHHHHHH
Confidence            5689999999    57789999999999998764


No 10 
>PF01497 Peripla_BP_2:  Periplasmic binding protein;  InterPro: IPR002491 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). Most bacterial importers employ a periplasmic substrate-binding protein (PBP) that delivers the ligand to the extracellular gate of the TM domains. These proteins bind their substrates selectively and with high affinity, which is thought to ensure the specificity of the transport reaction. Binding proteins in Gram-negative bacteria are present within the periplasm, whereas those in Gram-positive bacteria are tethered to the cell membrane via the acylation of a cysteine residue that is an integral component of a lipoprotein signal sequence. In planta expression of a high-affinity iron-uptake system involving the siderophore chrysobactin in Erwinia chrysanthemi 3937 contributes greatly to invasive growth of this pathogen on its natural host, African violets []. The cobalamin (vitamin B12) and the iron transport systems share many common attributes and probably evolved from the same origin [, ].  The periplasmic-binding domain is composed of two subdomains, each consisting of a central beta-sheet and surrounding alpha-helices, linked by a rigid alpha-helix. The substrate binding site is located in a cleft between the two alpha/beta subdomains [].; GO: 0005488 binding; PDB: 2X4L_A 1N4A_B 1N2Z_B 1N4D_B 4DBL_J 2QI9_F 3EIW_A 3EIX_A 3MWG_A 3MWF_A ....
Probab=42.52  E-value=61  Score=24.34  Aligned_cols=23  Identities=17%  Similarity=0.242  Sum_probs=19.8

Q ss_pred             HHHHHHHHHHHHHhCCHHHHhcc
Q 032201           96 QMIETYLNTLATVLGSMEEAKKN  118 (145)
Q Consensus        96 emId~Yv~TLAkVLGSEEEAKkk  118 (145)
                      +-+.-.++.||+++|-+++|++-
T Consensus        96 ~~~~~~i~~lg~~~g~~~~a~~~  118 (238)
T PF01497_consen   96 DDWKEQIRQLGKALGKEDQAEAL  118 (238)
T ss_dssp             HHHHHHHHHHHHHHTSHHHHHHH
T ss_pred             HHHHHHHHHHHHhcccHHHHHHH
Confidence            66788899999999999998754


No 11 
>cd01139 TroA_f Periplasmic binding protein TroA_f.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=41.79  E-value=44  Score=27.30  Aligned_cols=25  Identities=20%  Similarity=0.226  Sum_probs=18.5

Q ss_pred             CHHHHHHHHHHHHHHHhCCHHHHhcc
Q 032201           93 TREQMIETYLNTLATVLGSMEEAKKN  118 (145)
Q Consensus        93 sr~emId~Yv~TLAkVLGSEEEAKkk  118 (145)
                      +-+++.+ -++.||+++|.+|+|++-
T Consensus       130 ~~~~~~~-~i~~lg~i~g~~~~A~~l  154 (342)
T cd01139         130 PLKNTTP-SMRLLGKALGREERAEEF  154 (342)
T ss_pred             hhhhHHH-HHHHHHHHhCCHHHHHHH
Confidence            4455554 588999999999988653


No 12 
>PRK10576 iron-hydroxamate transporter substrate-binding subunit; Provisional
Probab=41.69  E-value=28  Score=28.27  Aligned_cols=24  Identities=21%  Similarity=0.080  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHhCCHHHHhc
Q 032201           94 REQMIETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        94 r~emId~Yv~TLAkVLGSEEEAKk  117 (145)
                      .-+.+...++.|++++|.|++|++
T Consensus       127 ~~~~~~~~i~~lg~ilG~e~~A~~  150 (292)
T PRK10576        127 PLAVARKSLVELAQRLNLEAAAET  150 (292)
T ss_pred             HHHHHHHHHHHHHHHhCCHHHHHH
Confidence            345667789999999999998865


No 13 
>PF13961 DUF4219:  Domain of unknown function (DUF4219)
Probab=40.68  E-value=1.8  Score=25.11  Aligned_cols=14  Identities=43%  Similarity=0.942  Sum_probs=11.4

Q ss_pred             cCCCCCceeEEEEc
Q 032201           72 LPGCDYNHWLIVME   85 (145)
Q Consensus        72 f~GcDy~HWLVvMe   85 (145)
                      |+|-+|.+|-+.|.
T Consensus         1 l~g~NY~~W~~~M~   14 (27)
T PF13961_consen    1 LDGTNYSTWKIRMK   14 (27)
T ss_pred             CCccCHHHHHHHHH
Confidence            67889999987774


No 14 
>cd01147 HemV-2 Metal binding protein HemV-2.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains. In addition, these proteins sometimes have a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).
Probab=39.47  E-value=32  Score=26.50  Aligned_cols=21  Identities=29%  Similarity=0.341  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHhCCHHHHhcc
Q 032201           98 IETYLNTLATVLGSMEEAKKN  118 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKkk  118 (145)
                      +...++.||+++|.+++|++-
T Consensus       113 ~~~~i~~lg~~~g~~~~a~~~  133 (262)
T cd01147         113 TPEQIRLLGKVLGKEERAEEL  133 (262)
T ss_pred             HHHHHHHHHHHhCCHHHHHHH
Confidence            457789999999999988753


No 15 
>PRK11411 fecB iron-dicitrate transporter substrate-binding subunit; Provisional
Probab=37.65  E-value=38  Score=27.52  Aligned_cols=26  Identities=19%  Similarity=0.328  Sum_probs=19.6

Q ss_pred             CHHHHHHHHHHHHHHHhCCHHHHhccc
Q 032201           93 TREQMIETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        93 sr~emId~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      +.++..+ .++.||+++|.|++|++-|
T Consensus       134 ~~~~~~~-~i~~lg~i~g~e~~a~~~i  159 (303)
T PRK11411        134 TYQENLQ-SAAIIGEVLGKKREMQARI  159 (303)
T ss_pred             CHHHHHH-HHHHHHHHhCCHHHHHHHH
Confidence            5566655 4688999999999998543


No 16 
>cd01146 FhuD Fe3+-siderophore binding domain FhuD.  These proteins have been shown to function as initial receptors in ABC transport of Fe3+-siderophores in many eubacterial species. They belong to the TroA-like superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA-like protein is comprised of two globular subdomains connected by a long alpha helix and binds its specific ligands in the cleft between these domains.
Probab=37.41  E-value=60  Score=25.24  Aligned_cols=25  Identities=32%  Similarity=0.262  Sum_probs=17.5

Q ss_pred             CHHHHHHHHHHHHHHHhCCHHHHhcc
Q 032201           93 TREQMIETYLNTLATVLGSMEEAKKN  118 (145)
Q Consensus        93 sr~emId~Yv~TLAkVLGSEEEAKkk  118 (145)
                      +.+++. ..++.|++++|-+|+|+.-
T Consensus        97 ~~~~~~-~~i~~lg~~~g~~~~a~~~  121 (256)
T cd01146          97 WLAEWK-ENLRLIAKALGKEEEAEKL  121 (256)
T ss_pred             cHHHHH-HHHHHHHHHhCcHHHHHHH
Confidence            344444 4788999999988877543


No 17 
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism]
Probab=37.37  E-value=46  Score=30.71  Aligned_cols=53  Identities=36%  Similarity=0.623  Sum_probs=42.1

Q ss_pred             CCCCCCcccccCCCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeee
Q 032201           62 SSNEPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQC  132 (145)
Q Consensus        62 s~~~~~~tiLf~GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c  132 (145)
                      .+-|.+..+++.+|-+|        |.+-+||+||-+.     +|.|+     .+|+++-+=-..|+||-.
T Consensus       173 ~~APe~si~iLhaCAhN--------PTGmDPT~EQW~q-----ia~vi-----k~k~lf~fFDiAYQGfAS  225 (410)
T KOG1412|consen  173 ESAPEGSIIILHACAHN--------PTGMDPTREQWKQ-----IADVI-----KSKNLFPFFDIAYQGFAS  225 (410)
T ss_pred             hhCCCCcEEeeeccccC--------CCCCCCCHHHHHH-----HHHHH-----HhcCceeeeehhhccccc
Confidence            33588889999999664        8899999999764     46676     567788887789999953


No 18 
>cd01149 HutB Hemin binding protein HutB.  These proteins have been shown to function as initial receptors in ABC transport of hemin and hemoproteins in many eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind the metal ion in the cleft between these domains.
Probab=35.11  E-value=47  Score=25.59  Aligned_cols=21  Identities=24%  Similarity=0.289  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHhCCHHHHhcc
Q 032201           98 IETYLNTLATVLGSMEEAKKN  118 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKkk  118 (145)
                      +..-++.|++++|.|++|++-
T Consensus        96 ~~~~~~~lg~i~g~e~~A~~l  116 (235)
T cd01149          96 LLTKIRQVAQALGVPEKGEAL  116 (235)
T ss_pred             HHHHHHHHHHHhCCHHHHHHH
Confidence            444688999999999988753


No 19 
>KOG4079 consensus Putative mitochondrial ribosomal protein mRpS25 [Translation, ribosomal structure and biogenesis]
Probab=35.02  E-value=25  Score=28.84  Aligned_cols=40  Identities=25%  Similarity=0.254  Sum_probs=25.2

Q ss_pred             CCCHHHHHHHHHHHHHH---HhCCHHHHhcccceeeecceeeeeee
Q 032201           91 APTREQMIETYLNTLAT---VLGSMEEAKKNMYAFSTTTYTGFQCT  133 (145)
Q Consensus        91 ~psr~emId~Yv~TLAk---VLGSEEEAKkkIYsvSt~tyfGF~c~  133 (145)
                      .-+++||++..++||.|   +|..||+-|+.   -+.-..||..|+
T Consensus        93 ~~~r~eI~~hl~K~lGKtee~lr~Ee~ek~~---k~nPAnFG~~c~  135 (169)
T KOG4079|consen   93 GMKREEIEKHLAKTLGKTEEVLRREELEKIA---KLNPANFGSKCE  135 (169)
T ss_pred             cccHHHHHHHHHHHhCccHHHHhHHHHHHHh---hcChhhhccccc
Confidence            55799999987777764   45444444433   234567777764


No 20 
>TIGR03659 IsdE heme ABC transporter, heme-binding protein isdE. This family of ABC substrate-binding proteins is observed primarily in close proximity with proteins localized to the cell wall and bearing the NEAT (NEAr Transporter, pfam05031) heme-binding domain. IsdE has been shown to bind heme and is involved in the process of scavenging heme for the purpose of obtaining iron.
Probab=34.40  E-value=43  Score=27.00  Aligned_cols=22  Identities=23%  Similarity=0.330  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHhCCHHHHhc
Q 032201           96 QMIETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        96 emId~Yv~TLAkVLGSEEEAKk  117 (145)
                      +-+...++.+|+++|.+++|++
T Consensus       125 ~~~~~~i~~lg~~~G~~~~A~~  146 (289)
T TIGR03659       125 DGMKKSITELGEKYGREEQAEK  146 (289)
T ss_pred             HHHHHHHHHHHHHhCCHHHHHH
Confidence            3355568999999999998865


No 21 
>cd01142 TroA_e Periplasmic binding protein TroA_e.  These proteins are predicted to function as initial receptors in the ABC metal ion uptake in eubacteria and archaea.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding mechanism.  A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=32.99  E-value=47  Score=26.33  Aligned_cols=22  Identities=23%  Similarity=0.372  Sum_probs=18.2

Q ss_pred             HHHHHHHHHHHhCCHHHHhccc
Q 032201           98 IETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      +...++.||+++|.+++|++-|
T Consensus       123 ~~~~~~~lg~~~g~~~~a~~~~  144 (289)
T cd01142         123 VKLTIALLGELLGRQEKAEALV  144 (289)
T ss_pred             HHHHHHHHHHHhCcHHHHHHHH
Confidence            5567899999999999988643


No 22 
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=32.42  E-value=59  Score=29.97  Aligned_cols=57  Identities=28%  Similarity=0.532  Sum_probs=39.6

Q ss_pred             CCCCcccccCCCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeeeeeCHHH
Q 032201           64 NEPRETIMLPGCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEET  138 (145)
Q Consensus        64 ~~~~~tiLf~GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c~I~EE~  138 (145)
                      -+.++.+|+-||        ...|.+-+||++|=.+     |+.++     +++.+--+=--.|+||+.-++|+.
T Consensus       169 a~~~~vvLLH~C--------cHNPTG~D~t~~qW~~-----l~~~~-----~~r~lip~~D~AYQGF~~GleeDa  225 (396)
T COG1448         169 APEGSVVLLHGC--------CHNPTGIDPTEEQWQE-----LADLI-----KERGLIPFFDIAYQGFADGLEEDA  225 (396)
T ss_pred             CCCCCEEEEecC--------CCCCCCCCCCHHHHHH-----HHHHH-----HHcCCeeeeehhhhhhccchHHHH
Confidence            377788899999        5689999999998643     23333     134444443449999999987764


No 23 
>cd01140 FatB Siderophore binding protein FatB.  These proteins have been shown to function as ABC-type initial receptors in the siderophore-mediated iron uptake in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=32.15  E-value=50  Score=25.80  Aligned_cols=20  Identities=35%  Similarity=0.626  Sum_probs=16.2

Q ss_pred             HHHHHHHHHHHhCCHHHHhc
Q 032201           98 IETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        98 Id~Yv~TLAkVLGSEEEAKk  117 (145)
                      +...++.||+++|.+|+|++
T Consensus       109 ~~~~i~~lg~~~g~~~~a~~  128 (270)
T cd01140         109 VKQNIETLGKIFGKEEEAKE  128 (270)
T ss_pred             HHHHHHHHHHHhCcHHHHHH
Confidence            34569999999999988864


No 24 
>PRK03379 vitamin B12-transporter protein BtuF; Provisional
Probab=31.30  E-value=44  Score=26.75  Aligned_cols=24  Identities=33%  Similarity=0.278  Sum_probs=17.5

Q ss_pred             CHHHHHHHHHHHHHHHhCCHHHHhc
Q 032201           93 TREQMIETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        93 sr~emId~Yv~TLAkVLGSEEEAKk  117 (145)
                      +-++ +...+++|++++|.+++|++
T Consensus       105 ~~~~-~~~~i~~lg~~~g~~~~A~~  128 (260)
T PRK03379        105 SIEQ-IANALRQLAPWSPQPEKAEQ  128 (260)
T ss_pred             CHHH-HHHHHHHHHHHcCCHHHHHH
Confidence            3444 34468899999999988855


No 25 
>COG4607 CeuA ABC-type enterochelin transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=30.09  E-value=33  Score=30.77  Aligned_cols=21  Identities=33%  Similarity=0.485  Sum_probs=17.6

Q ss_pred             HHHHHHHHhCCHHHHhcccce
Q 032201          101 YLNTLATVLGSMEEAKKNMYA  121 (145)
Q Consensus       101 Yv~TLAkVLGSEEEAKkkIYs  121 (145)
                      =+++|+++.|-|+|||+.+=+
T Consensus       158 n~e~Lg~IFgkE~eAk~~~~~  178 (320)
T COG4607         158 NIETLGKIFGKEEEAKELLAD  178 (320)
T ss_pred             HHHHHHHHhCchHHHHHHHHH
Confidence            467999999999999987643


No 26 
>PRK11630 hypothetical protein; Provisional
Probab=29.95  E-value=33  Score=27.53  Aligned_cols=36  Identities=14%  Similarity=0.391  Sum_probs=26.3

Q ss_pred             HHHHHHHhCCHHHHhcccceeeecceeeeeeee-CHHHHhhh
Q 032201          102 LNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTV-SEETSEKF  142 (145)
Q Consensus       102 v~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c~I-~EE~S~kl  142 (145)
                      ++..+++|     .+-.|-.+-|+|-||.+|.. +++..++|
T Consensus        17 i~~a~~~L-----~~G~vi~~PTdTvYgL~~d~~n~~Av~~l   53 (206)
T PRK11630         17 INQAVEIV-----RKGGVIVYPTDSGYALGCKIEDKNAMERI   53 (206)
T ss_pred             HHHHHHHH-----HCCCEEEEeCCChHhhhcCCCCHHHHHHH
Confidence            34445555     23469999999999999997 66777666


No 27 
>KOG1670 consensus Translation initiation factor 4F, cap-binding subunit (eIF-4E) and related cap-binding proteins [Translation, ribosomal structure and biogenesis]
Probab=27.61  E-value=99  Score=26.35  Aligned_cols=28  Identities=29%  Similarity=0.618  Sum_probs=23.1

Q ss_pred             eeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCC
Q 032201           79 HWLIVMEFPKDPAPTREQMIETYLNTLATVLGS  111 (145)
Q Consensus        79 HWLVvMe~P~~~~psr~emId~Yv~TLAkVLGS  111 (145)
                      .|+|++++-     +++++=...+.||...+|-
T Consensus       110 rW~~~~~k~-----~k~~lD~~WL~tLlalIGE  137 (212)
T KOG1670|consen  110 RWLITVPKS-----GKAELDELWLETLLALIGE  137 (212)
T ss_pred             eEEEEecCc-----chhhHHHHHHHHHHHHHhh
Confidence            799988742     6788888899999999984


No 28 
>cd00636 TroA-like Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between two globular domains linked by a single helix.  Many of these proteins also possess a low complexity region containing a metal-binding histidine-rich motif (repetitive HDH sequence).  The TroA-like proteins differ in their fold and ligand-binding mechanism from the PBPI and PBPII proteins, but are structurally similar, however, to the beta-subunit of the nitrogenase molybdenum-iron protein MoFe.   Most TroA-like proteins are encoded by ABC-type operons and appear to function as periplasmic components of ABC transporters in metal ion uptake.
Probab=26.71  E-value=70  Score=21.12  Aligned_cols=24  Identities=21%  Similarity=0.356  Sum_probs=19.3

Q ss_pred             HHHHHHHHHHHHHhCCHHHHhccc
Q 032201           96 QMIETYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus        96 emId~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      +=+.-.++.+++.||-+++|++-+
T Consensus        98 ~~~~~~i~~lg~~~~~~~~a~~~~  121 (148)
T cd00636          98 ENIKESIRLIGKALGKEENAEELI  121 (148)
T ss_pred             HHHHHHHHHHHHHHCChHHHHHHH
Confidence            336677899999999999998754


No 29 
>KOG1257 consensus NADP+-dependent malic enzyme [Energy production and conversion]
Probab=25.81  E-value=65  Score=31.09  Aligned_cols=24  Identities=25%  Similarity=0.436  Sum_probs=17.4

Q ss_pred             HHHHHHHHhC-CHHHHhcccceeeec
Q 032201          101 YLNTLATVLG-SMEEAKKNMYAFSTT  125 (145)
Q Consensus       101 Yv~TLAkVLG-SEEEAKkkIYsvSt~  125 (145)
                      -+..+.+- | +||||+++||=+.-+
T Consensus       329 ~v~~m~~~-Gl~~eeA~kkIwlvD~~  353 (582)
T KOG1257|consen  329 IVMAMVKE-GLSEEEARKKIWLVDSK  353 (582)
T ss_pred             HHHHHHHc-CCCHHHHhccEEEEecC
Confidence            34444544 7 999999999987643


No 30 
>PRK10957 iron-enterobactin transporter periplasmic binding protein; Provisional
Probab=25.18  E-value=67  Score=26.14  Aligned_cols=17  Identities=18%  Similarity=0.188  Sum_probs=14.4

Q ss_pred             HHHHHHHHhCCHHHHhc
Q 032201          101 YLNTLATVLGSMEEAKK  117 (145)
Q Consensus       101 Yv~TLAkVLGSEEEAKk  117 (145)
                      .++.|+++||.+|+|++
T Consensus       153 ~~~~lg~~lg~e~~A~~  169 (317)
T PRK10957        153 LATQLGEATGLEKQAAA  169 (317)
T ss_pred             HHHHHHHHhCcHHHHHH
Confidence            36899999999998864


No 31 
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=25.12  E-value=92  Score=24.91  Aligned_cols=32  Identities=22%  Similarity=0.290  Sum_probs=25.3

Q ss_pred             ceeEEEEcCCCCCCCCHHH-HHHHHHHHHHHHh
Q 032201           78 NHWLIVMEFPKDPAPTREQ-MIETYLNTLATVL  109 (145)
Q Consensus        78 ~HWLVvMe~P~~~~psr~e-mId~Yv~TLAkVL  109 (145)
                      ++++|+||.|+-..+.+.+ +.|.-+-.|+..|
T Consensus        59 ~~~v~~lDteG~~~~~~~~~~~~~~~~~l~~ll   91 (224)
T cd01851          59 EHAVLLLDTEGTDGRERGEFEDDARLFALATLL   91 (224)
T ss_pred             cceEEEEecCCcCccccCchhhhhHHHHHHHHH
Confidence            5899999999987887777 7777777776655


No 32 
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme. 4-oxalocrotonate tautomerase is a homohexamer in which each monomer is very small, at about 62 amino acids. Pro-1 of the mature protein serves as a general base. The enzyme functions in meta-cleavage pathways of aromatic hydrocarbon catabolism. Because several Arg residues located near the active site in the crystal structure of Pseudomonas putida are not conserved among all members of this family, because the literature describes a general role in the isomerization of beta,gamma-unsaturated enones to their alpha,beta-isomers, and because of the presence of fairly distantly related paralogs in Campylobacter jejuni, the family is regarded as not necessarily uniform in function.
Probab=24.95  E-value=63  Score=20.32  Aligned_cols=44  Identities=18%  Similarity=0.182  Sum_probs=29.6

Q ss_pred             CCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeeeee
Q 032201           91 APTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTV  134 (145)
Q Consensus        91 ~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c~I  134 (145)
                      .-.|++++..-.+.|+++||.-+|+-.-+..-.-...||||=..
T Consensus        14 ~eqK~~l~~~it~~l~~~lg~~~~~v~V~i~e~~~~~w~~gG~~   57 (63)
T TIGR00013        14 DEQKRQLIEGVTEAMAETLGANLESIVVIIDEMPKNNYGIGGEL   57 (63)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCcccEEEEEEEcCHHHeeECCEE
Confidence            44677888888999999999665555444443444677776443


No 33 
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=24.93  E-value=96  Score=23.86  Aligned_cols=26  Identities=35%  Similarity=0.496  Sum_probs=17.4

Q ss_pred             CCCCHHHHHHHHHHHHHHHh--C-CHHHH
Q 032201           90 PAPTREQMIETYLNTLATVL--G-SMEEA  115 (145)
Q Consensus        90 ~~psr~emId~Yv~TLAkVL--G-SEEEA  115 (145)
                      |+-.++|++++|.+-.....  | ||||+
T Consensus        18 p~~e~~e~l~~Y~e~f~d~~~~G~sEeei   46 (181)
T PF08006_consen   18 PEEEREEILEYYEEYFDDAGEEGKSEEEI   46 (181)
T ss_pred             CHHHHHHHHHHHHHHHHHhhhCCCCHHHH
Confidence            34468899999987776543  3 56654


No 34 
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]
Probab=24.54  E-value=26  Score=33.44  Aligned_cols=18  Identities=39%  Similarity=0.445  Sum_probs=14.5

Q ss_pred             eeecceeeeeeeeCHHHHh
Q 032201          122 FSTTTYTGFQCTVSEETSE  140 (145)
Q Consensus       122 vSt~tyfGF~c~I~EE~S~  140 (145)
                      |.- +.||||+.|+++..+
T Consensus       408 vKl-tDFGFcaqi~~~~~K  425 (550)
T KOG0578|consen  408 VKL-TDFGFCAQISEEQSK  425 (550)
T ss_pred             EEE-eeeeeeeccccccCc
Confidence            344 799999999999863


No 35 
>PF01026 TatD_DNase:  TatD related DNase The Pfam entry finds members not in the Prosite definition.;  InterPro: IPR001130 This family of proteins are related to a large superfamily of metalloenzymes []. TatD, a member of this family has been shown experimentally to be a DNase enzyme []. Allantoinase 3.5.2.5 from EC, N-isopropylammelide isopropyl amidohydrolase 3.5.1 from EC and the SCN1 protein from fission yeast belong to this family.; GO: 0016888 endodeoxyribonuclease activity, producing 5'-phosphomonoesters; PDB: 3E2V_B 1XWY_A 3GUW_D 3RCM_A 1ZZM_A 2XIO_A 1J6O_A 2GZX_A 3IPW_A 2Y1H_A ....
Probab=24.33  E-value=1.1e+02  Score=24.60  Aligned_cols=51  Identities=22%  Similarity=0.359  Sum_probs=38.1

Q ss_pred             ccCCCCCceeEEEEcCCC------CCCCCHHHHHHHHHHHHHHHhC-CHHHHhcccce
Q 032201           71 MLPGCDYNHWLIVMEFPK------DPAPTREQMIETYLNTLATVLG-SMEEAKKNMYA  121 (145)
Q Consensus        71 Lf~GcDy~HWLVvMe~P~------~~~psr~emId~Yv~TLAkVLG-SEEEAKkkIYs  121 (145)
                      +..-+.-+++||=.|.|-      .+.+...++|..=+++||++.| ++||+.+.+|.
T Consensus       191 ~~~~ip~drillETD~P~~~~~~~~~~~~~p~~i~~~~~~la~~~~~~~e~~~~~~~~  248 (255)
T PF01026_consen  191 LIKAIPLDRILLETDAPYLAPDPYRGKPNEPSNIPKVAQALAEIKGISLEELAQIIYE  248 (255)
T ss_dssp             HHHHS-GGGEEEE-BTTSSECTTSTTSE--GGGHHHHHHHHHHHHTSTHHHHHHHHHH
T ss_pred             HHhcCChhhEEEcCCCCcCCccccCCCCCChHHHHHHHHHHHHHcCCCHHHHHHHHHH
Confidence            335567788999999873      2367788889999999999999 99999998875


No 36 
>cd01138 FeuA Periplasmic binding protein FeuA.  These proteins have predicted to function as initial receptors in ABC transport of metal ions in some eubacterial species.  They belong to the TroA superfamily of periplasmic metal binding proteins that share a distinct fold and ligand binding mechanism. A typical TroA protein is comprised of two globular subdomains connected by a single helix and can bind their ligands in the cleft between these domains.
Probab=24.21  E-value=80  Score=24.36  Aligned_cols=19  Identities=32%  Similarity=0.480  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHhCCHHHHhc
Q 032201           99 ETYLNTLATVLGSMEEAKK  117 (145)
Q Consensus        99 d~Yv~TLAkVLGSEEEAKk  117 (145)
                      ...++.|+++||-+++|++
T Consensus       100 ~~~i~~lg~~~g~~~~a~~  118 (248)
T cd01138         100 EEQLKEIGKLLNKEDEAEK  118 (248)
T ss_pred             HHHHHHHHHHhCcHHHHHH
Confidence            3468999999999988876


No 37 
>PRK14048 ferrichrome/ferrioxamine B periplasmic transporter; Provisional
Probab=24.14  E-value=73  Score=26.85  Aligned_cols=20  Identities=20%  Similarity=0.219  Sum_probs=15.8

Q ss_pred             HHHHHHHHHhCCHHHHhccc
Q 032201          100 TYLNTLATVLGSMEEAKKNM  119 (145)
Q Consensus       100 ~Yv~TLAkVLGSEEEAKkkI  119 (145)
                      .-++.|++++|.||+|++-|
T Consensus       166 ~~i~~lG~i~g~ee~A~~li  185 (374)
T PRK14048        166 DNMRLLGKVFEREEQAEDFA  185 (374)
T ss_pred             HHHHHHHHHhCCHHHHHHHH
Confidence            45788999999999887543


No 38 
>PF04970 LRAT:  Lecithin retinol acyltransferase;  InterPro: IPR007053 This entry represents a conserved sequence region found in proteins from viruses, bacteria and eukaryotes. It contains a well-conserved NCEHF motif, though its function in these proteins is unknown.; PDB: 2KYT_A 4DOT_A 4FA0_A.
Probab=23.79  E-value=41  Score=24.30  Aligned_cols=22  Identities=32%  Similarity=0.604  Sum_probs=16.9

Q ss_pred             CCCCcccccCCCCCceeEEEEc
Q 032201           64 NEPRETIMLPGCDYNHWLIVME   85 (145)
Q Consensus        64 ~~~~~tiLf~GcDy~HWLVvMe   85 (145)
                      ..+.+-|.++..-|+||-|++.
T Consensus         7 ~~~GD~I~~~r~~y~H~gIYvG   28 (125)
T PF04970_consen    7 LKPGDHIEVPRGLYEHWGIYVG   28 (125)
T ss_dssp             --TT-EEEEEETTEEEEEEEEE
T ss_pred             CCCCCEEEEecCCccEEEEEec
Confidence            3567888899999999999876


No 39 
>PRK02260 S-ribosylhomocysteinase; Provisional
Probab=23.55  E-value=99  Score=25.04  Aligned_cols=31  Identities=32%  Similarity=0.651  Sum_probs=28.2

Q ss_pred             CCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHh
Q 032201           74 GCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVL  109 (145)
Q Consensus        74 GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVL  109 (145)
                      ||.--+.||+..     .++.++|++...++|..|+
T Consensus        81 GCrTGFYli~~g-----~~~~~~i~~l~~~~l~~i~  111 (158)
T PRK02260         81 GCRTGFYLILIG-----TPDEEDVADALKATLEDVL  111 (158)
T ss_pred             ccccccEEEEeC-----CCCHHHHHHHHHHHHHHHH
Confidence            999999999974     5778999999999999998


No 40 
>PF01282 Ribosomal_S24e:  Ribosomal protein S24e;  InterPro: IPR001976 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the S24e ribosomal proteins from eukaryotes and archaebacteria. These proteins have 101 to 148 amino acids.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2V94_B 1YWX_A 2G1D_A 3IZ6_U 1XN9_A 2XZM_P 2XZN_P 3U5G_Y 3J16_D 3IZB_U ....
Probab=23.26  E-value=1.6e+02  Score=20.87  Aligned_cols=42  Identities=26%  Similarity=0.394  Sum_probs=26.0

Q ss_pred             EEEcCCCCCCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeee
Q 032201           82 IVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGF  130 (145)
Q Consensus        82 VvMe~P~~~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF  130 (145)
                      |....|+.+-|||.|+.+    -||+.+|.   -+..|+=.+..+.||=
T Consensus         3 ~~v~h~g~~Tpsr~ei~~----klA~~~~~---~~~~ivv~~~~t~fG~   44 (84)
T PF01282_consen    3 FEVLHPGKPTPSRKEIRE----KLAAMLNV---DPDLIVVFGIKTEFGG   44 (84)
T ss_dssp             EEEE-SSSSS--HHHHHH----HHHHHHTS---TGCCEEEEEEEESSSS
T ss_pred             EEEECCCCCCCCHHHHHH----HHHHHhCC---CCCeEEEeccEecCCC
Confidence            456678889999999975    57888876   2344555555555553


No 41 
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid). It has a widespread application as biocatalyst for the synthesis of sialic acid and its derivatives. This enzyme has been shown to be quite specific for pyruvate as the donor, but flexible to a variety of D- and, to some extent, L-hexoses and pentoses as acceptor substrates. NAL is member of dihydrodipicolinate synthase family that comprises several pyruvate-dependent class I aldolases.
Probab=22.88  E-value=1.8e+02  Score=24.01  Aligned_cols=50  Identities=14%  Similarity=0.094  Sum_probs=32.3

Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeeeeeCHHHHhhhhC
Q 032201           87 PKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKG  144 (145)
Q Consensus        87 P~~~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c~I~EE~S~klk~  144 (145)
                      |---.++.+|+++||.+.+..+=+    ----||+.-..+    |..|+.|+..+|.+
T Consensus       105 P~y~~~~~~~i~~~~~~v~~a~~~----lpi~iYn~P~~t----g~~l~~~~~~~L~~  154 (288)
T cd00954         105 PFYYKFSFEEIKDYYREIIAAAAS----LPMIIYHIPALT----GVNLTLEQFLELFE  154 (288)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhcCC----CCEEEEeCcccc----CCCCCHHHHHHHhc
Confidence            434568999999999887654201    112367665322    67888888888764


No 42 
>PRK02220 4-oxalocrotonate tautomerase; Provisional
Probab=22.58  E-value=1.1e+02  Score=19.07  Aligned_cols=43  Identities=5%  Similarity=-0.004  Sum_probs=29.9

Q ss_pred             CCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeee
Q 032201           90 PAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQC  132 (145)
Q Consensus        90 ~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c  132 (145)
                      ..-.|.++++.--+.|++++|...|.-.-+..---...+|||-
T Consensus        13 s~eqk~~l~~~it~~l~~~~~~p~~~v~V~i~e~~~~~~~~gG   55 (61)
T PRK02220         13 TEEQLKALVKDVTAAVSKNTGAPAEHIHVIINEMSKNHYAVGG   55 (61)
T ss_pred             CHHHHHHHHHHHHHHHHHHhCcChhhEEEEEEEeChhHeEECC
Confidence            3446778888889999999997666655554544446666664


No 43 
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase:  Catalyzes the isomerization of unsaturated ketones. The structure is a homohexamer that is arranged as a trimer of dimers. The hexamer contains six active sites, each formed by residues from three monomers, two from one dimer and the third from a neighboring monomer.  Each monomer is a beta-alpha-beta fold with two small beta strands at the C-terminus that fold back on themselves. A pair of monomers form a dimer with two-fold symmetry, consisting of a 4-stranded beta sheet with two helices on one side and two additional small beta strands at each end. The dimers are assembled around a 3-fold axis of rotation to form a hexamer, with the short beta strands from each dimer contacting the neighboring dimers.
Probab=22.26  E-value=90  Score=19.13  Aligned_cols=41  Identities=15%  Similarity=0.203  Sum_probs=25.7

Q ss_pred             CCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeee
Q 032201           91 APTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQ  131 (145)
Q Consensus        91 ~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~  131 (145)
                      .-.|.++++.-.+.|++++|.-+|.-.-+..-.-...||||
T Consensus        13 ~eqk~~l~~~i~~~l~~~~g~~~~~v~V~i~e~~~~~~~~g   53 (58)
T cd00491          13 DEQKRELIERVTEAVSEILGAPEATIVVIIDEMPKENWGIG   53 (58)
T ss_pred             HHHHHHHHHHHHHHHHHHhCcCcccEEEEEEEeCchhceEC
Confidence            33577788888899999999655543333333333555555


No 44 
>PF07105 DUF1367:  Protein of unknown function (DUF1367);  InterPro: IPR009797 This entry is represented by Bacteriophage VT2phi_272, P37. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several highly conserved, hypothetical bacterial and phage proteins of around 200 resides in length. The function of this family is unknown.
Probab=21.74  E-value=1e+02  Score=25.95  Aligned_cols=36  Identities=19%  Similarity=0.401  Sum_probs=29.7

Q ss_pred             ccCCCCCceeEEEEcCCCCCCCCHHH--HHHHHHHHHHHHhCCH
Q 032201           71 MLPGCDYNHWLIVMEFPKDPAPTREQ--MIETYLNTLATVLGSM  112 (145)
Q Consensus        71 Lf~GcDy~HWLVvMe~P~~~~psr~e--mId~Yv~TLAkVLGSE  112 (145)
                      ||.=| |+||     -|.++..|++|  +|.-|++-||...|++
T Consensus        53 LL~lg-FeyW-----~P~gg~is~~E~~lv~g~v~~la~~~g~~   90 (196)
T PF07105_consen   53 LLNLG-FEYW-----EPTGGTISPAERKLVRGFVKFLASYAGSE   90 (196)
T ss_pred             HHHHH-HHHc-----cCCCCccCHHHHHHHHHHHHHHHHHhCCH
Confidence            55444 8999     58888888776  6999999999999987


No 45 
>PF14581 SseB_C:  SseB protein C-terminal domain
Probab=21.63  E-value=1.9e+02  Score=20.31  Aligned_cols=34  Identities=15%  Similarity=0.123  Sum_probs=23.3

Q ss_pred             CCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhC
Q 032201           74 GCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLG  110 (145)
Q Consensus        74 GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLG  110 (145)
                      .++-.||+|+.|..+   ...+++++.--+.+...++
T Consensus        45 ~~~~~~~li~vd~~~---~~~~~~~~~i~~~~~~~~~   78 (108)
T PF14581_consen   45 EDEQPSLLIGVDFDG---EDIEEIFQEIGRAARPYLP   78 (108)
T ss_pred             cCCCceEEEEEeccC---hhHHHHHHHHHHHhhhcCC
Confidence            567789999999986   4455666555555555553


No 46 
>TIGR00683 nanA N-acetylneuraminate lyase. N-acetylneuraminate lyase is also known as N-acetylneuraminic acid aldolase, sialic acid aldolase, or sialate lyase. It is an intracellular enzyme. The structure of this homotetrameric enzyme related to dihydrodipicolinate synthase is known. In Clostridium tertium, the enzyme appears to be in an operon with a secreted sialidase that releases sialic acid from host sialoglycoconjugates. In several E. coli strains, however, this enzyme is responsible for N-acetyl-D-neuraminic acid synthesis for capsule production by condensing N-acetyl-D-mannosamine and pyruvate.
Probab=21.13  E-value=2e+02  Score=24.01  Aligned_cols=59  Identities=12%  Similarity=0.019  Sum_probs=37.8

Q ss_pred             CCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCCHHHHhcccceeeecceeeeeeeeCHHHHhhhhC
Q 032201           76 DYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKG  144 (145)
Q Consensus        76 Dy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLGSEEEAKkkIYsvSt~tyfGF~c~I~EE~S~klk~  144 (145)
                      .....+|.  .|.--.++.+||++||-+.++++-    +--.-||++-..    .|..|+.|+..+|.+
T Consensus        96 Gad~v~v~--~P~y~~~~~~~i~~yf~~v~~~~~----~lpv~lYn~P~~----tg~~l~~~~i~~L~~  154 (290)
T TIGR00683        96 GYDCLSAV--TPFYYKFSFPEIKHYYDTIIAETG----GLNMIVYSIPFL----TGVNMGIEQFGELYK  154 (290)
T ss_pred             CCCEEEEe--CCcCCCCCHHHHHHHHHHHHhhCC----CCCEEEEeCccc----cccCcCHHHHHHHhc
Confidence            33444443  355567899999999987765421    122347887643    256888888888754


No 47 
>PF01876 RNase_P_p30:  RNase P subunit p30;  InterPro: IPR002738 Members of this protein family are part of the ribonuclease P complex () that takes part in endonucleolytic cleavage of RNA, removing 5'-extra-nucleotide from tRNA precursor. This process is essential for tRNA processing.; GO: 0004540 ribonuclease activity, 0008033 tRNA processing; PDB: 1V77_A 2CZV_A.
Probab=21.13  E-value=80  Score=23.63  Aligned_cols=17  Identities=53%  Similarity=0.608  Sum_probs=12.7

Q ss_pred             HHHHHHhC-CHHHHhccc
Q 032201          103 NTLATVLG-SMEEAKKNM  119 (145)
Q Consensus       103 ~TLAkVLG-SEEEAKkkI  119 (145)
                      --|+..|| ++++||+.|
T Consensus       130 ~~l~~~lGl~~~~a~~av  147 (150)
T PF01876_consen  130 INLLALLGLSEEEAKKAV  147 (150)
T ss_dssp             HHHHHHTT--HHHHHHTT
T ss_pred             HHHHHHhCCCHHHHHHHH
Confidence            34677999 999999875


No 48 
>PF02664 LuxS:  S-Ribosylhomocysteinase (LuxS);  InterPro: IPR003815 In bacteria, the regulation of gene expression in response to changes in cell density is called quorum sensing. Quorum-sensing bacteria produce, release, and respond to hormone-like molecules (autoinducers) that accumulate in the external environment as the cell population grows. For example, enteric bacteria use quorum sensing to regulate several traits that allow them to establish and maintain infection in their host, including motility, biofilm formation, and virulence-specific genes []. The LuxS/AI-2 system is one of several quorum sensing mechanisms. AI-2 (autoinducer-2) is a signalling molecule that functions in interspecies communication by regulating niche-specific genes with diverse functions in various bacteria, often in response to population density. LuxS (S-ribosylhomocysteinase; 4.4.1.21 from EC) is an autoinducer-production protein that has a metabolic function as a component of the activated methyl cycle. LuxS converts S-ribosylhomocysteine to homocysteine and 4,5-dihydroxy-2,3-pentanedione (DPD); DPD can then spontaneously cyclise to active AI-2 [, ]. LuxS is a homodimeric iron-dependent metalloenzyme containing two identical tetrahedral metal-binding sites similar to those found in peptidases and amidases []. ; GO: 0005506 iron ion binding, 0009372 quorum sensing; PDB: 1J6X_B 1VGX_A 1INN_B 1VJE_B 1J6V_A 1VH2_A 1J6W_B 1JOE_B 1J98_A 1IE0_A ....
Probab=20.98  E-value=2.1e+02  Score=23.23  Aligned_cols=34  Identities=26%  Similarity=0.482  Sum_probs=28.2

Q ss_pred             CCCCceeEEEEcCCCCCCCCHHHHHHHHHHHHHHHhCCH
Q 032201           74 GCDYNHWLIVMEFPKDPAPTREQMIETYLNTLATVLGSM  112 (145)
Q Consensus        74 GcDy~HWLVvMe~P~~~~psr~emId~Yv~TLAkVLGSE  112 (145)
                      ||.--+.||+..     .++.+++++...++|..|+.-+
T Consensus        81 GCrTGFYli~~g-----~~~~~~i~~l~~~~l~~i~~~~  114 (157)
T PF02664_consen   81 GCRTGFYLILWG-----DPSSEDIADLLKETLEFILEFE  114 (157)
T ss_dssp             TTSSEEEEEEES-----S--HHHHHHHHHHHHHHHHT-S
T ss_pred             ccccccEEEEeC-----CCCHHHHHHHHHHHHHHHHhcC
Confidence            999999999986     5678999999999999999744


No 49 
>COG1854 LuxS LuxS protein involved in autoinducer AI2 synthesis [Signal transduction mechanisms]
Probab=20.86  E-value=1.8e+02  Score=23.92  Aligned_cols=82  Identities=21%  Similarity=0.373  Sum_probs=51.5

Q ss_pred             cCCccCCC--CCcccccccCCCCCC--CCCccccccchhh---hcccCCCCCCCCCCCCCCCCccccc--CCCCCceeEE
Q 032201           12 SKPLLSSR--PQLTLGLRVGSPTLR--LPSRAHSRSILTV---RAGATDSEYSSKRSSSNEPRETIML--PGCDYNHWLI   82 (145)
Q Consensus        12 ~k~l~~~~--~~~~~~~~~~~~~~~--~p~~~~~~~~~~~---~~~~~~~~ys~~~~s~~~~~~tiLf--~GcDy~HWLV   82 (145)
                      .|+-+-++  -.+.+++||-.|+-.  .|..+++.--+.+   |....+.            -++|=|  -||.--+.|+
T Consensus        22 ~~~~~~~~Gd~It~fDiRf~qPNke~m~~~~iHTlEHL~A~~iRnh~~g~------------~~iID~SPMGCrTGFYm~   89 (161)
T COG1854          22 AKTMTGPKGDVITKFDIRFCQPNKEIMPPAGIHTLEHLLAGFIRNHLNGN------------VEIIDISPMGCRTGFYMI   89 (161)
T ss_pred             cccccCCCCCEEEEeEEEEecCChhhCCccchhhHHHHHHHHHHhcccCc------------eeEEEecCcccccceEEE
Confidence            44444333  355677787777655  4556666442222   3222211            122211  3999999999


Q ss_pred             EEcCCCCCCCCHHHHHHHHHHHHHHHhC
Q 032201           83 VMEFPKDPAPTREQMIETYLNTLATVLG  110 (145)
Q Consensus        83 vMe~P~~~~psr~emId~Yv~TLAkVLG  110 (145)
                      +..     .|+.++++|....++.-||+
T Consensus        90 l~G-----~~~~~~i~~~~~~~m~dvl~  112 (161)
T COG1854          90 LIG-----TPTSQDIADVLEATMKDVLK  112 (161)
T ss_pred             EEC-----CCCHHHHHHHHHHHHHHHHc
Confidence            985     56789999999999999997


No 50 
>PF08776 VASP_tetra:  VASP tetramerisation domain;  InterPro: IPR014885 Vasodilator-stimulated phosphoprotein (VASP) is an actin cytoskeletal regulatory protein. This region corresponds to the tetramerisation domain which forms a right handed alpha helical coiled coil structure []. ; PDB: 1USE_A 1USD_A.
Probab=20.71  E-value=1.2e+02  Score=19.90  Aligned_cols=15  Identities=27%  Similarity=0.430  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHHH
Q 032201           94 REQMIETYLNTLATV  108 (145)
Q Consensus        94 r~emId~Yv~TLAkV  108 (145)
                      |+||||+..+-|.++
T Consensus        24 K~EIIeA~~~eL~r~   38 (40)
T PF08776_consen   24 KEEIIEAIRQELSRR   38 (40)
T ss_dssp             HHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhcc
Confidence            678888888888764


No 51 
>PF08947 BPS:  BPS (Between PH and SH2) ;  InterPro: IPR015042 The BPS (Between PH and SH2) domain, comprised of 2 beta strands and a C-terminal helix, is an approximately 45 residue region found in the adaptor proteins Grb7/10/14 that mediates inhibition of the tyrosine kinase domain of the insulin receptor by binding of the N-terminal portion of the BPS domain to the substrate peptide groove of the kinase, acting as a pseudosubstrate inhibitor []. ; PDB: 2AUH_B.
Probab=20.59  E-value=49  Score=22.49  Aligned_cols=10  Identities=30%  Similarity=0.604  Sum_probs=6.0

Q ss_pred             eEEEEcCCCC
Q 032201           80 WLIVMEFPKD   89 (145)
Q Consensus        80 WLVvMe~P~~   89 (145)
                      =||.|||-+.
T Consensus         7 slVaMDFsG~   16 (49)
T PF08947_consen    7 SLVAMDFSGQ   16 (49)
T ss_dssp             --EEEE-SSS
T ss_pred             ceEEeeecCC
Confidence            4799999974


No 52 
>PLN02150 terpene synthase/cyclase family protein
Probab=20.40  E-value=49  Score=23.93  Aligned_cols=20  Identities=25%  Similarity=0.483  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHhC-CHHHHhcccce
Q 032201           98 IETYLNTLATVLG-SMEEAKKNMYA  121 (145)
Q Consensus        98 Id~Yv~TLAkVLG-SEEEAKkkIYs  121 (145)
                      |+||.+-=    | |||||.+.|-.
T Consensus        10 IeCYMke~----g~seeeA~~~i~~   30 (96)
T PLN02150         10 VNCYMKQH----GVTKEEAVSELKK   30 (96)
T ss_pred             HHHHhccC----CCCHHHHHHHHHH
Confidence            67776642    6 88888877643


No 53 
>PRK08187 pyruvate kinase; Validated
Probab=20.30  E-value=99  Score=28.76  Aligned_cols=30  Identities=20%  Similarity=0.403  Sum_probs=21.5

Q ss_pred             CCCCCHHHHHHHH-------------------HHHHHHHhCCHHHHhcc
Q 032201           89 DPAPTREQMIETY-------------------LNTLATVLGSMEEAKKN  118 (145)
Q Consensus        89 ~~~psr~emId~Y-------------------v~TLAkVLGSEEEAKkk  118 (145)
                      .+.|||+||-|.+                   |++|++++...|+.|.|
T Consensus       434 ~p~PTRAEvtDvAnadgaDavMLs~G~ypveaV~~l~~I~~~~e~~~~k  482 (493)
T PRK08187        434 KGLPSRAEMTDAAMAARAECVMLNKGPYLVEAVTFLDDLLARMDGHQHK  482 (493)
T ss_pred             CCCCchHHHHHHHhhcCCCEEeecCCCCHHHHHHHHHHHHHHHHHhhhc
Confidence            4789999998876                   56777777666655544


Done!