BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032236
(144 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1EQ7|A Chain A, Core Structure Of The Outer Membrane Lipoprotein From
Escherichia Coli At 1.9 Angstrom Resolution
Length = 56
Score = 25.8 bits (55), Expect = 8.2, Method: Compositional matrix adjust.
Identities = 12/36 (33%), Positives = 23/36 (63%)
Query: 62 DELTDMKKTLSVEVEQLRSEFQELRSTLQQQQDDVT 97
D+L+ +TL+ +V+QL ++ +RS +Q +DD
Sbjct: 7 DQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAA 42
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.306 0.125 0.332
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,007,675
Number of Sequences: 62578
Number of extensions: 144869
Number of successful extensions: 355
Number of sequences better than 100.0: 66
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 46
Number of HSP's that attempted gapping in prelim test: 324
Number of HSP's gapped (non-prelim): 73
length of query: 144
length of database: 14,973,337
effective HSP length: 89
effective length of query: 55
effective length of database: 9,403,895
effective search space: 517214225
effective search space used: 517214225
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 46 (22.3 bits)