BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032236
         (144 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1EQ7|A Chain A, Core Structure Of The Outer Membrane Lipoprotein From
          Escherichia Coli At 1.9 Angstrom Resolution
          Length = 56

 Score = 25.8 bits (55), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 62 DELTDMKKTLSVEVEQLRSEFQELRSTLQQQQDDVT 97
          D+L+   +TL+ +V+QL ++   +RS +Q  +DD  
Sbjct: 7  DQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAA 42


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.306    0.125    0.332 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,007,675
Number of Sequences: 62578
Number of extensions: 144869
Number of successful extensions: 355
Number of sequences better than 100.0: 66
Number of HSP's better than 100.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 46
Number of HSP's that attempted gapping in prelim test: 324
Number of HSP's gapped (non-prelim): 73
length of query: 144
length of database: 14,973,337
effective HSP length: 89
effective length of query: 55
effective length of database: 9,403,895
effective search space: 517214225
effective search space used: 517214225
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 46 (22.3 bits)