Citrus Sinensis ID: 032244

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGGRRITSSGQRDLDQVAGRIAVVAP
cccccccccccHHHHHHHHHHHHHHccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHcccccccccccccccccccHHHHHHHHHHHHcccEEcccccccEEccHHHHHHHHHHHHHHHccc
****KNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGG***************GSVARHILHQLQDTNIIELDS****RITSSGQRDLDQVAGRIAVV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METAKNVKDVSPHEFVKAYAAHLKRSGKIELPTWNDIVKTGTLKELAPYDPDWYYIRAASMARKIYLRGGLGVGSFRRIYGGGKRNGSRPPHFSKSSGSVARHILHQLQDTNIIELDSKGGRRITSSGQRDLDQVAGRIAVVAP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S19 confidentP40978
40S ribosomal protein S19-2 confidentQ9LF30
40S ribosomal protein S19-1 confidentQ9SGA6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain S
Confidence level:very confident
Coverage over the Query: 4-142
View the alignment between query and template
View the model in PyMOL