Citrus Sinensis ID: 032313


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MSFRGTNASSGMGVADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRAR
cccccccccccccccHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEcccccccHHHHHccccccccEEEEEEEEEEccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHcccCEEEEEEcccccccHHHHHHHHc
*************VADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRAR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFRGTNASSGMGVADHSKSTYLELQRKKVHRYVIFKIDEKKKEVVVEKTGGPAESYDDFTASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPDVSRIRAKMLYATSKDRFRRELDGIHYEIQATDPSEMDLEVIRDRAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Actin-depolymerizing factor 6 Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers.confidentQ9ZSK2
Actin-depolymerizing factor 11 Actin-depolymerizing protein. Severs actin filaments (F-actin) and binds to actin monomers.confidentQ2QLT8
Cofilin Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. Binding to F-actin is regulated by tropomyosin. It is the major component of intranuclear and cytoplasmic actin rods. Required for accumulation of actin at the cell division site via depolymerizing actin at the cell ends. In association with myosin II has a role in the assembly of the contractile ring via severing actin filaments. Involved in the maintenance of the contractile ring once formed. In association with profilin and capping protein, has a role in the mitotic reorganization of the actin cytoskeleton.probableP0CM06

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F7S, chain A
Confidence level:very confident
Coverage over the Query: 9-132
View the alignment between query and template
View the model in PyMOL