Citrus Sinensis ID: 032315


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MKDVEGTCSGRHGFAVAITGAESIGKGLIRNGTVLVTFLVRCQCIVFRPFKGEILGAGVTMVNKMGFLAEAGAVQIFCLIPDDMELQTGDLPSYTTSDGSVKIQKDCELWLKIIGTQVDVTEIEKARREVGKQRADKHPVEAM
cccEEEEECccEEEEEEEEEEccccccEEEcccccEEEEEEEEEEEEECccccEEEEEEEEEEccEEEEEEcccEEEEccccccccccccccCEEcccccEEEccccEEEEEEEEEEEcccHHHHHHHHHccccccccccccc
MKDVEGTCSGRHGFAVAITGAESIGKGLIRNGTVLVTFLVRCQCIVFRPFKGEILGAGVTMVNKMGFLAEAGAVQIFCLIPDDMELQTGDLPSYTTSDGSVKIQKDCELWLKIIGTQVDVTEI********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDVEGTCSGRHGFAVAITGAESIGKGLIRNGTVLVTFLVRCQCIVFRPFKGEILGAGVTMVNKMGFLAEAGAVQIFCLIPDDMELQTGDLPSYTTSDGSVKIQKDCELWLKIIGTQVDVTEIEKARREVGKQRADKHPVEAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase II subunit RPB7 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB7 is part of a subcomplex with RPB4 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA.probableP38421
DNA-directed RNA polymerase II subunit RPB7 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB7 is part of a subcomplex with RPB4 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA.probableP46279

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C35, chain B
Confidence level:very confident
Coverage over the Query: 2-132
View the alignment between query and template
View the model in PyMOL