BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032329
         (143 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1MG2|D Chain D, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG2|H Chain H, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG2|L Chain L, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG2|P Chain P, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG3|D Chain D, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG3|H Chain H, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG3|L Chain L, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
 pdb|1MG3|P Chain P, Mutation Of Alpha Phe55 Of Methylamine Dehydrogenase
           Alters The Reorganization Energy And Electronic Coupling
           For Its Electron Transfer Reaction With Amicyanin
          Length = 155

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 29/72 (40%), Gaps = 15/72 (20%)

Query: 26  YTRGQINDIELRDSVWKYLFQ----GKLTYLYGNKGDQMAPVMGGLGGTL--------LV 73
           Y  G+I    L D+ W Y       G  + LYG    QM P+ G L  TL         V
Sbjct: 64  YAEGKIG-PGLNDAYWTYPGNETDVGLFSTLYGGATGQMGPMWGSL--TLDEMLRTMAWV 120

Query: 74  RKLPAADPKRVS 85
           R L   DPK  S
Sbjct: 121 RHLYTGDPKDAS 132


>pdb|2MTA|C Chain C, Crystal Structure Of A Ternary Electron Transfer Complex
           Between Methylamine Dehydrogenase, Amicyanin And A
           C-Type Cytochrome
 pdb|2GC4|D Chain D, Structural Comparison Of The Oxidized Ternary Electron
           Transfer Complex Of Methylamine Dehydrogenase, Amicyanin
           And Cytochrome C551i From Paracoccus Denitrificans With
           The Substrate-Reduced, Copper Free Complex At 1.9 A
           Resolution.
 pdb|2GC4|H Chain H, Structural Comparison Of The Oxidized Ternary Electron
           Transfer Complex Of Methylamine Dehydrogenase, Amicyanin
           And Cytochrome C551i From Paracoccus Denitrificans With
           The Substrate-Reduced, Copper Free Complex At 1.9 A
           Resolution.
 pdb|2GC4|L Chain L, Structural Comparison Of The Oxidized Ternary Electron
           Transfer Complex Of Methylamine Dehydrogenase, Amicyanin
           And Cytochrome C551i From Paracoccus Denitrificans With
           The Substrate-Reduced, Copper Free Complex At 1.9 A
           Resolution.
 pdb|2GC4|P Chain P, Structural Comparison Of The Oxidized Ternary Electron
           Transfer Complex Of Methylamine Dehydrogenase, Amicyanin
           And Cytochrome C551i From Paracoccus Denitrificans With
           The Substrate-Reduced, Copper Free Complex At 1.9 A
           Resolution.
 pdb|2GC7|D Chain D, Substrate Reduced, Copper Free Complex Of Methylamine
           Dehydrogenase, Amicyanin And Cytochrome C551i From
           Paracoccus Denitrificans.
 pdb|2GC7|H Chain H, Substrate Reduced, Copper Free Complex Of Methylamine
           Dehydrogenase, Amicyanin And Cytochrome C551i From
           Paracoccus Denitrificans.
 pdb|2GC7|L Chain L, Substrate Reduced, Copper Free Complex Of Methylamine
           Dehydrogenase, Amicyanin And Cytochrome C551i From
           Paracoccus Denitrificans.
 pdb|2GC7|P Chain P, Substrate Reduced, Copper Free Complex Of Methylamine
           Dehydrogenase, Amicyanin And Cytochrome C551i From
           Paracoccus Denitrificans
          Length = 147

 Score = 27.7 bits (60), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 29/73 (39%), Gaps = 15/73 (20%)

Query: 25  SYTRGQINDIELRDSVWKYLFQ----GKLTYLYGNKGDQMAPVMGGLGGTL--------L 72
            Y  G+I    L D+ W Y       G  + LYG    QM P+ G L  TL         
Sbjct: 63  HYAEGKIGP-GLNDAYWTYPGNETDVGLFSTLYGGATGQMGPMWGSL--TLDEMLRTMAW 119

Query: 73  VRKLPAADPKRVS 85
           VR L   DPK  S
Sbjct: 120 VRHLYTGDPKDAS 132


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.135    0.407 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,626,595
Number of Sequences: 62578
Number of extensions: 186756
Number of successful extensions: 448
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 446
Number of HSP's gapped (non-prelim): 6
length of query: 143
length of database: 14,973,337
effective HSP length: 89
effective length of query: 54
effective length of database: 9,403,895
effective search space: 507810330
effective search space used: 507810330
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 46 (22.3 bits)