Query         032350
Match_columns 142
No_of_seqs    173 out of 776
Neff          6.9 
Searched_HMMs 46136
Date          Fri Mar 29 12:57:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032350.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032350hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4198 RNA-binding Ran Zn-fin  99.7 3.7E-18   8E-23  137.2   6.2  121   17-142     5-165 (280)
  2 KOG4198 RNA-binding Ran Zn-fin  99.7 1.9E-17 4.2E-22  133.1   6.7  123   15-141    59-267 (280)
  3 PF00641 zf-RanBP:  Zn-finger i  98.9 5.5E-10 1.2E-14   61.5   1.8   30   17-46      1-30  (30)
  4 KOG1995 Conserved Zn-finger pr  98.8 2.1E-09 4.5E-14   88.8   3.7  126   11-142    62-244 (351)
  5 PF00641 zf-RanBP:  Zn-finger i  98.8 6.2E-09 1.3E-13   57.2   2.5   29  112-142     1-29  (30)
  6 smart00547 ZnF_RBZ Zinc finger  98.5 6.3E-08 1.4E-12   51.3   1.3   26   19-44      1-26  (26)
  7 smart00547 ZnF_RBZ Zinc finger  98.3 3.2E-07   7E-12   48.6   1.5   25   63-89      1-25  (26)
  8 KOG1995 Conserved Zn-finger pr  97.6 7.1E-05 1.5E-09   62.2   4.5   34   59-93    213-246 (351)
  9 PF12773 DZR:  Double zinc ribb  96.9  0.0012 2.6E-08   39.7   3.0   50   23-87      1-50  (50)
 10 PRK14559 putative protein seri  95.1   0.021 4.5E-07   51.5   3.3   50   22-91      3-52  (645)
 11 PF12773 DZR:  Double zinc ribb  94.3    0.05 1.1E-06   32.5   2.7   50   67-138     1-50  (50)
 12 KOG4477 RING1 interactor RYBP   92.6   0.052 1.1E-06   41.9   0.9   29   18-46     22-50  (228)
 13 KOG4477 RING1 interactor RYBP   91.1     0.1 2.2E-06   40.3   1.1   31  109-141    18-48  (228)
 14 PF13248 zf-ribbon_3:  zinc-rib  90.9    0.11 2.4E-06   27.2   0.9   23   21-43      3-25  (26)
 15 PF13248 zf-ribbon_3:  zinc-rib  90.9    0.15 3.2E-06   26.7   1.3   23   65-89      3-25  (26)
 16 PF13240 zinc_ribbon_2:  zinc-r  90.0    0.17 3.6E-06   25.9   1.0   22   22-43      1-22  (23)
 17 PF13240 zinc_ribbon_2:  zinc-r  88.8    0.26 5.6E-06   25.2   1.2   22   66-89      1-22  (23)
 18 PRK14559 putative protein seri  86.4    0.66 1.4E-05   42.0   3.1   48   66-140     3-50  (645)
 19 KOG4345 NF-kappa B regulator A  86.2   0.092   2E-06   47.5  -2.4  123   16-142     3-210 (774)
 20 cd00350 rubredoxin_like Rubred  84.1    0.95 2.1E-05   24.9   1.9   26   64-91      1-28  (33)
 21 PRK14714 DNA polymerase II lar  82.4     1.5 3.2E-05   42.6   3.6   54   19-93    666-722 (1337)
 22 PRK04136 rpl40e 50S ribosomal   80.9    0.81 1.8E-05   27.7   0.9   24   19-42     13-36  (48)
 23 cd00729 rubredoxin_SM Rubredox  79.3     1.7 3.8E-05   24.1   1.9   26   64-91      2-29  (34)
 24 PRK04136 rpl40e 50S ribosomal   68.9     3.1 6.6E-05   25.2   1.2   25   63-89     13-37  (48)
 25 COG1552 RPL40A Ribosomal prote  68.6     1.1 2.4E-05   27.2  -0.7   22   22-43     16-37  (50)
 26 COG1773 Rubredoxin [Energy pro  65.9     9.1  0.0002   23.8   3.0   16   57-74     29-44  (55)
 27 COG1592 Rubrerythrin [Energy p  65.5     3.9 8.5E-05   31.0   1.6   26   20-45    134-160 (166)
 28 PF00301 Rubredoxin:  Rubredoxi  65.1     8.2 0.00018   23.1   2.6   16   57-74     27-42  (47)
 29 cd00730 rubredoxin Rubredoxin;  63.9     8.4 0.00018   23.3   2.5   16   57-74     27-42  (50)
 30 PF10571 UPF0547:  Uncharacteri  60.9     4.8  0.0001   21.1   0.9   21   22-42      2-22  (26)
 31 PF12172 DUF35_N:  Rubredoxin-l  59.5       5 0.00011   22.3   0.9   22   66-89     13-34  (37)
 32 PRK14714 DNA polymerase II lar  58.5      12 0.00025   36.7   3.6   50   63-140   666-718 (1337)
 33 COG1592 Rubrerythrin [Energy p  56.9     7.1 0.00015   29.6   1.6   27   64-92    134-161 (166)
 34 cd04718 BAH_plant_2 BAH, or Br  54.3     8.9 0.00019   28.6   1.7   20   13-32     11-30  (148)
 35 COG1545 Predicted nucleic-acid  45.9     8.8 0.00019   28.0   0.6   37    3-44     17-53  (140)
 36 PF14803 Nudix_N_2:  Nudix N-te  44.9      14  0.0003   20.6   1.1   32   82-128     2-33  (34)
 37 PF10058 DUF2296:  Predicted in  38.1      20 0.00044   22.0   1.3   13   18-30     42-54  (54)
 38 PRK13130 H/ACA RNA-protein com  37.2      35 0.00077   21.2   2.3   25   66-94      7-31  (56)
 39 PF04810 zf-Sec23_Sec24:  Sec23  33.5      34 0.00075   19.4   1.7   15  113-129    22-36  (40)
 40 PRK04023 DNA polymerase II lar  32.9      59  0.0013   31.5   3.9   61   11-94    617-677 (1121)
 41 PF11023 DUF2614:  Protein of u  32.2      25 0.00053   25.1   1.1   29   17-45     66-96  (114)
 42 smart00778 Prim_Zn_Ribbon Zinc  32.2      38 0.00082   19.2   1.7   10   19-28     24-33  (37)
 43 COG3478 Predicted nucleic-acid  31.9      25 0.00055   22.6   1.0   15   63-79      3-17  (68)
 44 PRK05452 anaerobic nitric oxid  31.3      60  0.0013   28.3   3.6   44   18-74    423-466 (479)
 45 PHA00626 hypothetical protein   30.7      39 0.00084   21.2   1.6   11   63-75     22-32  (59)
 46 COG1545 Predicted nucleic-acid  30.1      37 0.00081   24.7   1.8   23   66-90     31-53  (140)
 47 PRK11788 tetratricopeptide rep  29.4      39 0.00085   27.2   2.0   28   18-45    352-379 (389)
 48 PF08271 TF_Zn_Ribbon:  TFIIB z  28.9      34 0.00074   19.5   1.2   12  113-126    17-28  (43)
 49 PF12523 DUF3725:  Protein of u  28.2      30 0.00065   22.5   0.9   27    6-32     45-71  (74)
 50 TIGR02098 MJ0042_CXXC MJ0042 f  28.1      29 0.00062   19.1   0.7    8   66-75     27-34  (38)
 51 PRK00398 rpoP DNA-directed RNA  26.3      47   0.001   19.2   1.4    9   81-89     22-30  (46)
 52 PF09862 DUF2089:  Protein of u  25.7      34 0.00074   24.3   0.9   22   23-44      1-22  (113)
 53 TIGR00595 priA primosomal prot  25.4      57  0.0012   28.7   2.4   24   64-90    240-263 (505)
 54 PF03604 DNA_RNApol_7kD:  DNA d  21.0      91   0.002   17.0   1.8    6   71-76      5-10  (32)
 55 PRK15103 paraquat-inducible me  20.8      82  0.0018   27.1   2.4   34   10-43    210-244 (419)
 56 PF01020 Ribosomal_L40e:  Ribos  20.5      75  0.0016   19.5   1.5   26   63-90     16-43  (52)
 57 PRK11823 DNA repair protein Ra  20.3      82  0.0018   27.2   2.4   28   18-45      5-32  (446)
 58 PRK11788 tetratricopeptide rep  20.3      64  0.0014   26.0   1.6   30   60-91    350-379 (389)

No 1  
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=99.73  E-value=3.7e-18  Score=137.25  Aligned_cols=121  Identities=34%  Similarity=0.727  Sum_probs=93.6

Q ss_pred             CCC-CeeccccCccccccccccccCCCCCCCCCCCc------------ccccccccccCCCcccCCCCCCCeecCCCcCc
Q 032350           17 PGG-DWMCAACQHQNFKKREACQRCGYPKYGGPDVS------------TYLCNRTEVLAGDWYCTAMNCGAHNYASRPNC   83 (142)
Q Consensus        17 ~~g-dW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~------------~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C   83 (142)
                      +.| ||.|..|...||..+..|.+|..+++. ..+.            .+.+....+++|||.|+  .|+++||++|..|
T Consensus         5 r~g~~~~~~~~~~~~~~~~~~c~~c~~~~~~-i~~~~~~~~tid~~~~~~~~~~~~~~pgdw~c~--~c~~~n~arr~~c   81 (280)
T KOG4198|consen    5 RKGVDSLKRLCLHVNFDERDSCGRCSLSRAY-IQPDDDEARTIDVMRLLLTNSKDPPRPGDWNCP--LCGFHNSARRLLC   81 (280)
T ss_pred             cccCCcccchhhhhccccccccccccCCccc-ccccccccCccchhhhcccccCCCCCCcccccC--ccchhhHHHhhhc
Confidence            344 999999999999999999999999944 2111            11235678999999999  8999999999999


Q ss_pred             cccCCCCCCccccc-ccccC-----------C------CCCCC---------CCCCCCCeeecCCCCCceeccCCccccC
Q 032350           84 YRCGAAKTDYACAN-MMAYG-----------T------DGSVP---------PGWKSGDWICNRMGCGVHNYASRMVCYK  136 (142)
Q Consensus        84 ~~C~~~~~~~~~~~-~~g~g-----------~------~~~~~---------~~~~~gdW~C~~~~C~~~N~a~r~~C~~  136 (142)
                      .+|+.++++..+.+ ++..|           .      ...+.         ..+++|||+|+  .|+||||+++.+|++
T Consensus        82 ~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~GDW~Cp--~C~fhNfarn~~C~r  159 (280)
T KOG4198|consen   82 FRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRSGDWECP--GCNFHNFARNSECFR  159 (280)
T ss_pred             ceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCccccCcccC--CCCceeccccchhhh
Confidence            99999988766531 11111           0      00000         13789999999  899999999999999


Q ss_pred             CCCCCC
Q 032350          137 CKTPRE  142 (142)
Q Consensus       137 C~~~k~  142 (142)
                      |+++++
T Consensus       160 C~~~r~  165 (280)
T KOG4198|consen  160 CGAKRP  165 (280)
T ss_pred             cCCcCc
Confidence            999875


No 2  
>KOG4198 consensus RNA-binding Ran Zn-finger protein and related proteins [General function prediction only]
Probab=99.70  E-value=1.9e-17  Score=133.11  Aligned_cols=123  Identities=35%  Similarity=0.754  Sum_probs=90.9

Q ss_pred             CCCCCCeeccccCccccccccccccCCCCCCCCCC----Cccc--------cc-----------c----c-----ccccC
Q 032350           15 SLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPD----VSTY--------LC-----------N----R-----TEVLA   62 (142)
Q Consensus        15 ~~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~----~~~~--------~~-----------~----~-----~~~~~   62 (142)
                      ..++|||.|+.|+++||++|+.|++|+.+++.-..    +.++        ++           +    +     .+.++
T Consensus        59 ~~~pgdw~c~~c~~~n~arr~~c~~c~~s~~~~~~~~~~~~~g~~~~~~~~r~~~~~~~~~~~~g~~~~~n~~~~r~~~~  138 (280)
T KOG4198|consen   59 PPRPGDWNCPLCGFHNSARRLLCFRCGFSKVPLDSALTAPNSGSRSLQTGPRYFKGDWLCPRCPGLGFSRNNKPKRPWRS  138 (280)
T ss_pred             CCCCcccccCccchhhHHHhhhcceecccCCCccccccCCCCcccccccccccccCCCCCCCCCCCcccccccccCCccc
Confidence            56799999999999999999999999998864221    1110        00           0    1     14689


Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCCCCCccc-------c----c-----cc-------------ccCC---------C
Q 032350           63 GDWYCTAMNCGAHNYASRPNCYRCGAAKTDYAC-------A----N-----MM-------------AYGT---------D  104 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~r~~C~~C~~~~~~~~~-------~----~-----~~-------------g~g~---------~  104 (142)
                      |||+|+  .|++|||+++..|.+|+++++....       .    +     ..             .++.         .
T Consensus       139 GDW~Cp--~C~fhNfarn~~C~rC~~~r~~~a~~~~~~s~~~~~~~~s~~~~~~~~t~~~~~~r~~~~~~~~~~~~d~~~  216 (280)
T KOG4198|consen  139 GDWECP--GCNFHNFARNSECFRCGAKRPLAALLGNQASEATEHDWLSKVADSSSSTRFESLLRCNARGEMSESRVDGAD  216 (280)
T ss_pred             cCcccC--CCCceeccccchhhhcCCcCcccccccccccccccccccccccccccceecccchhhcccCccccccccccc
Confidence            999999  9999999999999999999987441       0    0     00             0000         0


Q ss_pred             ----------------CCCCCCCCCCCeeecCCCCCceeccCCccccCCCCCC
Q 032350          105 ----------------GSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTPR  141 (142)
Q Consensus       105 ----------------~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~~~k  141 (142)
                                      ..+....+.+||.|+  .|.++||.++.+|..|..++
T Consensus       217 ~~~~~~~~~e~~~~~~sr~s~~~~dgdw~~~--s~~~~~~r~r~a~~~c~~~~  267 (280)
T KOG4198|consen  217 VKGNFSSDDESRLEPLSRGSKSSRDGDWMCE--SCKAENFRRRNACLKCISPR  267 (280)
T ss_pred             ccccccccccccccccccCcccccCCCcccc--cccchhhhhhhhhhccccCc
Confidence                            001123678999999  79999999999999998775


No 3  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=98.92  E-value=5.5e-10  Score=61.51  Aligned_cols=30  Identities=40%  Similarity=0.991  Sum_probs=24.7

Q ss_pred             CCCCeeccccCccccccccccccCCCCCCC
Q 032350           17 PGGDWMCAACQHQNFKKREACQRCGYPKYG   46 (142)
Q Consensus        17 ~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~   46 (142)
                      ++|+|.|+.|+++|++.+..|.+|+++||+
T Consensus         1 k~g~W~C~~C~~~N~~~~~~C~~C~~~rp~   30 (30)
T PF00641_consen    1 KEGDWKCPSCTFMNPASRSKCVACGAPRPG   30 (30)
T ss_dssp             -SSSEEETTTTEEEESSSSB-TTT--BTTB
T ss_pred             CCcCccCCCCcCCchHHhhhhhCcCCCCcC
Confidence            478999999999999999999999999984


No 4  
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]
Probab=98.84  E-value=2.1e-09  Score=88.76  Aligned_cols=126  Identities=24%  Similarity=0.328  Sum_probs=85.1

Q ss_pred             CCCCCCCCCCeecc--ccCccccccccccccCCCCCCCCCCCc--------ccc-cccccccCCCcccCCCCCCCeecCC
Q 032350           11 DKKMSLPGGDWMCA--ACQHQNFKKREACQRCGYPKYGGPDVS--------TYL-CNRTEVLAGDWYCTAMNCGAHNYAS   79 (142)
Q Consensus        11 ~~~~~~~~gdW~C~--~C~~~Nf~~r~~C~~C~~prp~~~~~~--------~~~-~~~~~~~~gdW~C~~~~C~~~N~~~   79 (142)
                      .+....+.++|.|+  .|.+.||.+..+|..|+.+|.... +-        +.. -+...+..-||.|.  .|.++||+.
T Consensus        62 ~~s~~~ti~v~g~~d~~~~~~~~~~f~qcg~ikrnK~t~k-Pki~~y~dkeT~~~KGeatvS~~D~~~a--kaai~~~ag  138 (351)
T KOG1995|consen   62 DKSDNETIFVWGCPDSVCENDNADFFLQCGVIKRNKRTGK-PKIKIYTDKETGAPKGEATVSYEDPPAA--KAAIEWFAG  138 (351)
T ss_pred             cccccccceeeccCccchHHHHHHHHhhcceeccCCCCCC-cchhccccccccCcCCceeeeecChhhh--hhhhhhhcc
Confidence            36667778999998  799999999999999999998742 11        100 12334556688888  888888887


Q ss_pred             CcCccccCCCCCCcccc---c------------ccccC-------------CCCC------------------CCCCCCC
Q 032350           80 RPNCYRCGAAKTDYACA---N------------MMAYG-------------TDGS------------------VPPGWKS  113 (142)
Q Consensus        80 r~~C~~C~~~~~~~~~~---~------------~~g~g-------------~~~~------------------~~~~~~~  113 (142)
                      +..|.  .+++...+..   +            ..+|+             ....                  .......
T Consensus       139 kdf~g--n~ikvs~a~~r~~ve~~rg~~~~~~g~g~fg~~~~grg~~~G~gg~~~~~~~~~rGg~~~~g~~g~~~~~~~d  216 (351)
T KOG1995|consen  139 KDFCG--NTIKVSLAERRTGVESVRGGYPNDGGAGEFGRLRGGRGGPGGPGGGDGEAGKGDRGGVPDGGESGGGNVQDED  216 (351)
T ss_pred             ccccC--CCchhhhhhhccCcccccccccCcCCCCCccccccCCCCCCCCCCccccccccccCCcCCCcccCCccccccc
Confidence            77776  3333211100   0            00000             0000                  0112467


Q ss_pred             CCeeecCCCCCceeccCCccccCCCCCCC
Q 032350          114 GDWICNRMGCGVHNYASRMVCYKCKTPRE  142 (142)
Q Consensus       114 gdW~C~~~~C~~~N~a~r~~C~~C~~~k~  142 (142)
                      +||.|+ +.|.+.||+++..|++|+++|+
T Consensus       217 ~Dw~c~-~~c~N~nfa~r~~cnrck~~Kp  244 (351)
T KOG1995|consen  217 GDWDCP-PSCGNRNFAWREECNRCKAPKP  244 (351)
T ss_pred             cccccc-ccccccccccccccccccCCCc
Confidence            899999 7999999999999999999985


No 5  
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=98.75  E-value=6.2e-09  Score=57.24  Aligned_cols=29  Identities=48%  Similarity=0.996  Sum_probs=23.6

Q ss_pred             CCCCeeecCCCCCceeccCCccccCCCCCCC
Q 032350          112 KSGDWICNRMGCGVHNYASRMVCYKCKTPRE  142 (142)
Q Consensus       112 ~~gdW~C~~~~C~~~N~a~r~~C~~C~~~k~  142 (142)
                      ++|+|.|+  .|+++|++++..|++|+++||
T Consensus         1 k~g~W~C~--~C~~~N~~~~~~C~~C~~~rp   29 (30)
T PF00641_consen    1 KEGDWKCP--SCTFMNPASRSKCVACGAPRP   29 (30)
T ss_dssp             -SSSEEET--TTTEEEESSSSB-TTT--BTT
T ss_pred             CCcCccCC--CCcCCchHHhhhhhCcCCCCc
Confidence            36899999  799999999999999999986


No 6  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=98.46  E-value=6.3e-08  Score=51.35  Aligned_cols=26  Identities=50%  Similarity=1.198  Sum_probs=24.5

Q ss_pred             CCeeccccCccccccccccccCCCCC
Q 032350           19 GDWMCAACQHQNFKKREACQRCGYPK   44 (142)
Q Consensus        19 gdW~C~~C~~~Nf~~r~~C~~C~~pr   44 (142)
                      |||.|+.|+++|++.+..|.+|++|.
T Consensus         1 g~W~C~~C~~~N~~~~~~C~~C~~p~   26 (26)
T smart00547        1 GDWECPACTFLNFASRSKCFACGAPX   26 (26)
T ss_pred             CcccCCCCCCcChhhhccccccCCcC
Confidence            79999999999999999999999873


No 7  
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=98.29  E-value=3.2e-07  Score=48.57  Aligned_cols=25  Identities=52%  Similarity=1.285  Sum_probs=23.9

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCC
Q 032350           63 GDWYCTAMNCGAHNYASRPNCYRCGAA   89 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~r~~C~~C~~~   89 (142)
                      |||+|+  .|+++|++.+..|..|++|
T Consensus         1 g~W~C~--~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        1 GDWECP--ACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             CcccCC--CCCCcChhhhccccccCCc
Confidence            699999  9999999999999999986


No 8  
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only]
Probab=97.62  E-value=7.1e-05  Score=62.20  Aligned_cols=34  Identities=41%  Similarity=0.902  Sum_probs=31.2

Q ss_pred             cccCCCcccCCCCCCCeecCCCcCccccCCCCCCc
Q 032350           59 EVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDY   93 (142)
Q Consensus        59 ~~~~gdW~C~~~~C~~~N~~~r~~C~~C~~~~~~~   93 (142)
                      ...++||.|+ ..|.++||+.+..|++|.++||..
T Consensus       213 ~~~d~Dw~c~-~~c~N~nfa~r~~cnrck~~Kp~~  246 (351)
T KOG1995|consen  213 QDEDGDWDCP-PSCGNRNFAWREECNRCKAPKPER  246 (351)
T ss_pred             cccccccccc-ccccccccccccccccccCCCccc
Confidence            4578899999 999999999999999999999865


No 9  
>PF12773 DZR:  Double zinc ribbon
Probab=96.86  E-value=0.0012  Score=39.73  Aligned_cols=50  Identities=32%  Similarity=0.671  Sum_probs=42.8

Q ss_pred             ccccCccccccccccccCCCCCCCCCCCcccccccccccCCCcccCCCCCCCeecCCCcCccccC
Q 032350           23 CAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCG   87 (142)
Q Consensus        23 C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C~~C~   87 (142)
                      |+.|+..|-.....|..|+++-+.             .....++|+  .|+..|...+..|..||
T Consensus         1 Cp~Cg~~~~~~~~fC~~CG~~l~~-------------~~~~~~~C~--~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    1 CPHCGTPNPDDAKFCPHCGTPLPP-------------PDQSKKICP--NCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCcCCcCCccccCChhhcCChhh-------------ccCCCCCCc--CCcCCCcCCcCccCccc
Confidence            789999999999999999998661             112368999  99999999999999996


No 10 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=95.05  E-value=0.021  Score=51.52  Aligned_cols=50  Identities=30%  Similarity=0.731  Sum_probs=43.4

Q ss_pred             eccccCccccccccccccCCCCCCCCCCCcccccccccccCCCcccCCCCCCCeecCCCcCccccCCCCC
Q 032350           22 MCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKT   91 (142)
Q Consensus        22 ~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C~~C~~~~~   91 (142)
                      .|+.|++.|-.....|.+|+++-..              +    .|+  .||..+-.....|..||++-.
T Consensus         3 ~Cp~Cg~~n~~~akFC~~CG~~l~~--------------~----~Cp--~CG~~~~~~~~fC~~CG~~~~   52 (645)
T PRK14559          3 ICPQCQFENPNNNRFCQKCGTSLTH--------------K----PCP--QCGTEVPVDEAHCPNCGAETG   52 (645)
T ss_pred             cCCCCCCcCCCCCccccccCCCCCC--------------C----cCC--CCCCCCCcccccccccCCccc
Confidence            5999999999999999999886421              0    599  999999999999999998854


No 11 
>PF12773 DZR:  Double zinc ribbon
Probab=94.30  E-value=0.05  Score=32.51  Aligned_cols=50  Identities=28%  Similarity=0.658  Sum_probs=41.0

Q ss_pred             cCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCCCCCeeecCCCCCceeccCCccccCCC
Q 032350           67 CTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCK  138 (142)
Q Consensus        67 C~~~~C~~~N~~~r~~C~~C~~~~~~~~~~~~~g~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~  138 (142)
                      |+  .|+..|-.....|..||++-+.                  .....+.|+  .|+..|......|..|+
T Consensus         1 Cp--~Cg~~~~~~~~fC~~CG~~l~~------------------~~~~~~~C~--~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen    1 CP--HCGTPNPDDAKFCPHCGTPLPP------------------PDQSKKICP--NCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CC--CcCCcCCccccCChhhcCChhh------------------ccCCCCCCc--CCcCCCcCCcCccCccc
Confidence            67  8999999999999999988551                  113468899  69999999999998885


No 12 
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription]
Probab=92.55  E-value=0.052  Score=41.88  Aligned_cols=29  Identities=28%  Similarity=0.628  Sum_probs=26.4

Q ss_pred             CCCeeccccCccccccccccccCCCCCCC
Q 032350           18 GGDWMCAACQHQNFKKREACQRCGYPKYG   46 (142)
Q Consensus        18 ~gdW~C~~C~~~Nf~~r~~C~~C~~prp~   46 (142)
                      .|.|.|..|.|.|-+-.-.|+.|+..+..
T Consensus        22 eg~WdCsvCTFrNsAeAfkC~vCdvRKGT   50 (228)
T KOG4477|consen   22 EGKWDCSVCTFRNSAEAFKCFVCDVRKGT   50 (228)
T ss_pred             cCceeeeeeeecchhhhhheeeecccccc
Confidence            47899999999999999999999987754


No 13 
>KOG4477 consensus RING1 interactor RYBP and related Zn-finger-containing proteins [Transcription]
Probab=91.11  E-value=0.1  Score=40.32  Aligned_cols=31  Identities=29%  Similarity=0.792  Sum_probs=26.3

Q ss_pred             CCCCCCCeeecCCCCCceeccCCccccCCCCCC
Q 032350          109 PGWKSGDWICNRMGCGVHNYASRMVCYKCKTPR  141 (142)
Q Consensus       109 ~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~~~k  141 (142)
                      +....|-|+|.  .|+|.|-|-.-.|++|...+
T Consensus        18 p~~Deg~WdCs--vCTFrNsAeAfkC~vCdvRK   48 (228)
T KOG4477|consen   18 PNDDEGKWDCS--VCTFRNSAEAFKCFVCDVRK   48 (228)
T ss_pred             CccccCceeee--eeeecchhhhhheeeecccc
Confidence            34557889999  79999999999999998654


No 14 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=90.92  E-value=0.11  Score=27.20  Aligned_cols=23  Identities=22%  Similarity=0.599  Sum_probs=20.2

Q ss_pred             eeccccCccccccccccccCCCC
Q 032350           21 WMCAACQHQNFKKREACQRCGYP   43 (142)
Q Consensus        21 W~C~~C~~~Nf~~r~~C~~C~~p   43 (142)
                      ..|+.|+..+......|..|+++
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCcccCCcCCcccccChhhCCC
Confidence            46999999999999999999875


No 15 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=90.91  E-value=0.15  Score=26.71  Aligned_cols=23  Identities=39%  Similarity=0.871  Sum_probs=20.2

Q ss_pred             cccCCCCCCCeecCCCcCccccCCC
Q 032350           65 WYCTAMNCGAHNYASRPNCYRCGAA   89 (142)
Q Consensus        65 W~C~~~~C~~~N~~~r~~C~~C~~~   89 (142)
                      ..|+  .|+..+......|..||++
T Consensus         3 ~~Cp--~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCP--NCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCc--ccCCcCCcccccChhhCCC
Confidence            5789  9999999999999999975


No 16 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=89.97  E-value=0.17  Score=25.92  Aligned_cols=22  Identities=27%  Similarity=0.768  Sum_probs=19.1

Q ss_pred             eccccCccccccccccccCCCC
Q 032350           22 MCAACQHQNFKKREACQRCGYP   43 (142)
Q Consensus        22 ~C~~C~~~Nf~~r~~C~~C~~p   43 (142)
                      .|+.|+..+......|..|+++
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCCc
Confidence            3889999999999999999875


No 17 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=88.84  E-value=0.26  Score=25.20  Aligned_cols=22  Identities=41%  Similarity=0.942  Sum_probs=18.7

Q ss_pred             ccCCCCCCCeecCCCcCccccCCC
Q 032350           66 YCTAMNCGAHNYASRPNCYRCGAA   89 (142)
Q Consensus        66 ~C~~~~C~~~N~~~r~~C~~C~~~   89 (142)
                      .|+  .||..+-.....|..||++
T Consensus         1 ~Cp--~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCP--NCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCc--ccCCCCCCcCcchhhhCCc
Confidence            378  8999999999999999875


No 18 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=86.45  E-value=0.66  Score=42.02  Aligned_cols=48  Identities=27%  Similarity=0.641  Sum_probs=39.5

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCCCCCeeecCCCCCceeccCCccccCCCCC
Q 032350           66 YCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYASRMVCYKCKTP  140 (142)
Q Consensus        66 ~C~~~~C~~~N~~~r~~C~~C~~~~~~~~~~~~~g~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~r~~C~~C~~~  140 (142)
                      +|+  .|+..|-..+..|..||++-..                   +    .|+  .|+..|-.....|..|+++
T Consensus         3 ~Cp--~Cg~~n~~~akFC~~CG~~l~~-------------------~----~Cp--~CG~~~~~~~~fC~~CG~~   50 (645)
T PRK14559          3 ICP--QCQFENPNNNRFCQKCGTSLTH-------------------K----PCP--QCGTEVPVDEAHCPNCGAE   50 (645)
T ss_pred             cCC--CCCCcCCCCCccccccCCCCCC-------------------C----cCC--CCCCCCCcccccccccCCc
Confidence            689  9999999999999999876321                   0    388  6999999999999999875


No 19 
>KOG4345 consensus NF-kappa B regulator AP20/Cezanne [Signal transduction mechanisms]
Probab=86.17  E-value=0.092  Score=47.53  Aligned_cols=123  Identities=12%  Similarity=0.119  Sum_probs=80.4

Q ss_pred             CCCCCeeccccCccccccccccccCCCCCCCCC----CC---c---------cc-------------cc----------c
Q 032350           16 LPGGDWMCAACQHQNFKKREACQRCGYPKYGGP----DV---S---------TY-------------LC----------N   56 (142)
Q Consensus        16 ~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~----~~---~---------~~-------------~~----------~   56 (142)
                      .....|.|..|.+.|+....+|..|.+.++..+    |+   +         ++             .+          .
T Consensus         3 ~~~~~W~~~~~~~~~lp~al~lS~~~~s~~~~~~l~eDifk~~n~~~~~~~sd~~~~r~v~~~~~~p~f~~s~~~r~~~~   82 (774)
T KOG4345|consen    3 TSAEKWACELCDYMTLPMALVLSDFRRSTGAEPGLAEDIFKGKNWDIHAALSDYEQLRQVHEMNLTPSFCESGQPREIIH   82 (774)
T ss_pred             chhHHHHHHhhccccCchhhHHHHHHhccCCCCCcchhhccCCCccceeecccHHHHHhhhccCCCCcccccCCcccccc
Confidence            345689999999999999999999999887542    11   0         00             00          1


Q ss_pred             cc-cccCCCcccCCCCCCCeecCCCcCccccCCCCCCccc-c--cc--cccCCC----------------CCCCCC---C
Q 032350           57 RT-EVLAGDWYCTAMNCGAHNYASRPNCYRCGAAKTDYAC-A--NM--MAYGTD----------------GSVPPG---W  111 (142)
Q Consensus        57 ~~-~~~~gdW~C~~~~C~~~N~~~r~~C~~C~~~~~~~~~-~--~~--~g~g~~----------------~~~~~~---~  111 (142)
                      +. ....-.|.|+  .|...|+++...|.+|-.-+.+... +  ..  .++-.+                .....+   +
T Consensus        83 ~s~~~~~~k~~~~--~~~~lnw~re~R~~~~ls~~gd~~~~~~q~pq~s~~~qs~~VaL~~~l~~~l~~~dt~~~N~l~w  160 (774)
T KOG4345|consen   83 KSLIDRNIKWPRP--SLQRLNWPREKRLSRGLSHAGDMPILAFQLPQLSVYEQSTPVALEKALFRLLPLADTGDGNCLMW  160 (774)
T ss_pred             cccccccccCCch--HhhhhhHHHHHHHHHHhhccCCCccchhccchhhccccccchhhhhhhhhcccccccCCccchhh
Confidence            21 3345689999  9999999999999998554421110 0  00  111000                000001   0


Q ss_pred             C---------------------CCCeeecCCCCCceeccCCccccCCCCCCC
Q 032350          112 K---------------------SGDWICNRMGCGVHNYASRMVCYKCKTPRE  142 (142)
Q Consensus       112 ~---------------------~gdW~C~~~~C~~~N~a~r~~C~~C~~~k~  142 (142)
                      .                     ..+|+|.  .|++.|+++-..|.+|+++++
T Consensus       161 ~~h~lvlqk~l~t~l~~~~~rw~~eW~~l--ik~ass~pr~~r~~~~~~~~~  210 (774)
T KOG4345|consen  161 GFHDLVLQKALYTGLCYGTERWNDEWTEL--IKLASSEPRMHRSGNGGTGGG  210 (774)
T ss_pred             hhhhHHHHHHHHHhhchhhHHHHHHHHHH--HHhhcccchhhhcccCCCCCC
Confidence            0                     1349999  799999999999999987753


No 20 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=84.05  E-value=0.95  Score=24.90  Aligned_cols=26  Identities=31%  Similarity=0.583  Sum_probs=17.7

Q ss_pred             CcccCCCCCCCeecCC--CcCccccCCCCC
Q 032350           64 DWYCTAMNCGAHNYAS--RPNCYRCGAAKT   91 (142)
Q Consensus        64 dW~C~~~~C~~~N~~~--r~~C~~C~~~~~   91 (142)
                      .|+|.  .||++-...  --.|+.|++++.
T Consensus         1 ~~~C~--~CGy~y~~~~~~~~CP~Cg~~~~   28 (33)
T cd00350           1 KYVCP--VCGYIYDGEEAPWVCPVCGAPKD   28 (33)
T ss_pred             CEECC--CCCCEECCCcCCCcCcCCCCcHH
Confidence            38888  888885543  446777777653


No 21 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=82.45  E-value=1.5  Score=42.58  Aligned_cols=54  Identities=30%  Similarity=0.760  Sum_probs=41.3

Q ss_pred             CCeeccccCccccccccccccCCCCCCCCCCCcccccccccccCCCcccCCCCCCCeecCC---CcCccccCCCCCCc
Q 032350           19 GDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYAS---RPNCYRCGAAKTDY   93 (142)
Q Consensus        19 gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~---r~~C~~C~~~~~~~   93 (142)
                      +.=.|+.|+...+..  .|..|+++...                 .+.|+  .|+...-..   +..|..|+.+....
T Consensus       666 ~~rkCPkCG~~t~~~--fCP~CGs~te~-----------------vy~CP--sCGaev~~des~a~~CP~CGtplv~~  722 (1337)
T PRK14714        666 GRRRCPSCGTETYEN--RCPDCGTHTEP-----------------VYVCP--DCGAEVPPDESGRVECPRCDVELTPY  722 (1337)
T ss_pred             EEEECCCCCCccccc--cCcccCCcCCC-----------------ceeCc--cCCCccCCCccccccCCCCCCccccc
Confidence            447899999988764  99999987421                 46899  999965443   67899999886543


No 22 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=80.92  E-value=0.81  Score=27.70  Aligned_cols=24  Identities=29%  Similarity=0.871  Sum_probs=22.1

Q ss_pred             CCeeccccCccccccccccccCCC
Q 032350           19 GDWMCAACQHQNFKKREACQRCGY   42 (142)
Q Consensus        19 gdW~C~~C~~~Nf~~r~~C~~C~~   42 (142)
                      ..++|-.|+..|....+.|.+|+.
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            467899999999999999999987


No 23 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=79.32  E-value=1.7  Score=24.12  Aligned_cols=26  Identities=35%  Similarity=0.792  Sum_probs=20.1

Q ss_pred             CcccCCCCCCCeecCC--CcCccccCCCCC
Q 032350           64 DWYCTAMNCGAHNYAS--RPNCYRCGAAKT   91 (142)
Q Consensus        64 dW~C~~~~C~~~N~~~--r~~C~~C~~~~~   91 (142)
                      -|.|.  .||++=...  -..|+.|++++.
T Consensus         2 ~~~C~--~CG~i~~g~~~p~~CP~Cg~~~~   29 (34)
T cd00729           2 VWVCP--VCGYIHEGEEAPEKCPICGAPKE   29 (34)
T ss_pred             eEECC--CCCCEeECCcCCCcCcCCCCchH
Confidence            49999  999985543  358999998764


No 24 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=68.91  E-value=3.1  Score=25.21  Aligned_cols=25  Identities=28%  Similarity=0.639  Sum_probs=22.7

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCC
Q 032350           63 GDWYCTAMNCGAHNYASRPNCYRCGAA   89 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~r~~C~~C~~~   89 (142)
                      ..++|-  .|+..|-.+++.|.+||..
T Consensus        13 ~k~ICr--kC~ARnp~~A~~CRKCg~~   37 (48)
T PRK04136         13 NKKICM--RCNARNPWRATKCRKCGYK   37 (48)
T ss_pred             cccchh--cccCCCCccccccccCCCC
Confidence            578999  9999999999999999963


No 25 
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=68.65  E-value=1.1  Score=27.22  Aligned_cols=22  Identities=32%  Similarity=0.988  Sum_probs=20.0

Q ss_pred             eccccCccccccccccccCCCC
Q 032350           22 MCAACQHQNFKKREACQRCGYP   43 (142)
Q Consensus        22 ~C~~C~~~Nf~~r~~C~~C~~p   43 (142)
                      +|-.|+..|....+.|.+|+.-
T Consensus        16 IC~rC~Arnp~~A~kCRkC~~k   37 (50)
T COG1552          16 ICRRCYARNPPRATKCRKCGYK   37 (50)
T ss_pred             HHHHhcCCCCcchhHHhhccCC
Confidence            6889999999999999999774


No 26 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=65.90  E-value=9.1  Score=23.82  Aligned_cols=16  Identities=44%  Similarity=1.051  Sum_probs=12.8

Q ss_pred             cccccCCCcccCCCCCCC
Q 032350           57 RTEVLAGDWYCTAMNCGA   74 (142)
Q Consensus        57 ~~~~~~gdW~C~~~~C~~   74 (142)
                      ++..-+.+|.|+  .|+.
T Consensus        29 ~fedlPd~w~CP--~Cg~   44 (55)
T COG1773          29 PFEDLPDDWVCP--ECGV   44 (55)
T ss_pred             chhhCCCccCCC--CCCC
Confidence            467788999999  7765


No 27 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=65.53  E-value=3.9  Score=30.98  Aligned_cols=26  Identities=35%  Similarity=0.828  Sum_probs=19.6

Q ss_pred             CeeccccCccccc-cccccccCCCCCC
Q 032350           20 DWMCAACQHQNFK-KREACQRCGYPKY   45 (142)
Q Consensus        20 dW~C~~C~~~Nf~-~r~~C~~C~~prp   45 (142)
                      -|.|+.|++.-.. ....|.-|++|+.
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~k~  160 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAPKE  160 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCChHH
Confidence            6999999887554 5567888887763


No 28 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=65.14  E-value=8.2  Score=23.11  Aligned_cols=16  Identities=50%  Similarity=1.034  Sum_probs=9.1

Q ss_pred             cccccCCCcccCCCCCCC
Q 032350           57 RTEVLAGDWYCTAMNCGA   74 (142)
Q Consensus        57 ~~~~~~gdW~C~~~~C~~   74 (142)
                      .+...+.||.|+  .|+.
T Consensus        27 ~F~~Lp~~w~CP--~C~a   42 (47)
T PF00301_consen   27 PFEDLPDDWVCP--VCGA   42 (47)
T ss_dssp             -GGGS-TT-B-T--TTSS
T ss_pred             CHHHCCCCCcCc--CCCC
Confidence            466778899999  7664


No 29 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=63.92  E-value=8.4  Score=23.34  Aligned_cols=16  Identities=50%  Similarity=1.034  Sum_probs=11.3

Q ss_pred             cccccCCCcccCCCCCCC
Q 032350           57 RTEVLAGDWYCTAMNCGA   74 (142)
Q Consensus        57 ~~~~~~gdW~C~~~~C~~   74 (142)
                      .+...+.+|.|+  .|+.
T Consensus        27 ~f~~Lp~~w~CP--~C~a   42 (50)
T cd00730          27 PFEDLPDDWVCP--VCGA   42 (50)
T ss_pred             CHhHCCCCCCCC--CCCC
Confidence            355567899999  6653


No 30 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=60.89  E-value=4.8  Score=21.11  Aligned_cols=21  Identities=29%  Similarity=0.857  Sum_probs=15.7

Q ss_pred             eccccCccccccccccccCCC
Q 032350           22 MCAACQHQNFKKREACQRCGY   42 (142)
Q Consensus        22 ~C~~C~~~Nf~~r~~C~~C~~   42 (142)
                      .||.|+..-......|..|+-
T Consensus         2 ~CP~C~~~V~~~~~~Cp~CG~   22 (26)
T PF10571_consen    2 TCPECGAEVPESAKFCPHCGY   22 (26)
T ss_pred             cCCCCcCCchhhcCcCCCCCC
Confidence            477887777777777777764


No 31 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=59.54  E-value=5  Score=22.30  Aligned_cols=22  Identities=36%  Similarity=1.085  Sum_probs=13.6

Q ss_pred             ccCCCCCCCeecCCCcCccccCCC
Q 032350           66 YCTAMNCGAHNYASRPNCYRCGAA   89 (142)
Q Consensus        66 ~C~~~~C~~~N~~~r~~C~~C~~~   89 (142)
                      .|.  .|+.+-|.-+..|..|++.
T Consensus        13 rC~--~Cg~~~~pPr~~Cp~C~s~   34 (37)
T PF12172_consen   13 RCR--DCGRVQFPPRPVCPHCGSD   34 (37)
T ss_dssp             E-T--TT--EEES--SEETTTT--
T ss_pred             EcC--CCCCEecCCCcCCCCcCcc
Confidence            488  9999999999999999854


No 32 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=58.50  E-value=12  Score=36.74  Aligned_cols=50  Identities=28%  Similarity=0.836  Sum_probs=36.0

Q ss_pred             CCcccCCCCCCCeecCCCcCccccCCCCCCcccccccccCCCCCCCCCCCCCCeeecCCCCCceeccC---CccccCCCC
Q 032350           63 GDWYCTAMNCGAHNYASRPNCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNYAS---RMVCYKCKT  139 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~r~~C~~C~~~~~~~~~~~~~g~g~~~~~~~~~~~gdW~C~~~~C~~~N~a~---r~~C~~C~~  139 (142)
                      +.-.|+  .||...+..  .|..||++...                      .+.|+  .|+...-..   +..|..|+.
T Consensus       666 ~~rkCP--kCG~~t~~~--fCP~CGs~te~----------------------vy~CP--sCGaev~~des~a~~CP~CGt  717 (1337)
T PRK14714        666 GRRRCP--SCGTETYEN--RCPDCGTHTEP----------------------VYVCP--DCGAEVPPDESGRVECPRCDV  717 (1337)
T ss_pred             EEEECC--CCCCccccc--cCcccCCcCCC----------------------ceeCc--cCCCccCCCccccccCCCCCC
Confidence            347899  999988764  99999987421                      34787  588765333   557888876


Q ss_pred             C
Q 032350          140 P  140 (142)
Q Consensus       140 ~  140 (142)
                      +
T Consensus       718 p  718 (1337)
T PRK14714        718 E  718 (1337)
T ss_pred             c
Confidence            5


No 33 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=56.85  E-value=7.1  Score=29.58  Aligned_cols=27  Identities=33%  Similarity=0.767  Sum_probs=21.5

Q ss_pred             CcccCCCCCCCeecC-CCcCccccCCCCCC
Q 032350           64 DWYCTAMNCGAHNYA-SRPNCYRCGAAKTD   92 (142)
Q Consensus        64 dW~C~~~~C~~~N~~-~r~~C~~C~~~~~~   92 (142)
                      -|+|+  .||+.-.. .-..|+.||+|+..
T Consensus       134 ~~vC~--vCGy~~~ge~P~~CPiCga~k~~  161 (166)
T COG1592         134 VWVCP--VCGYTHEGEAPEVCPICGAPKEK  161 (166)
T ss_pred             EEEcC--CCCCcccCCCCCcCCCCCChHHH
Confidence            69999  99998776 33469999998753


No 34 
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function. BAH domains are found in a variety of proteins playing roles in transcriptional silencing and the remodeling of chromatin. It is assumed that in most or all of these instances the BAH domain mediates protein-protein interactions.
Probab=54.30  E-value=8.9  Score=28.56  Aligned_cols=20  Identities=30%  Similarity=0.876  Sum_probs=14.5

Q ss_pred             CCCCCCCCeeccccCccccc
Q 032350           13 KMSLPGGDWMCAACQHQNFK   32 (142)
Q Consensus        13 ~~~~~~gdW~C~~C~~~Nf~   32 (142)
                      -....+|||.|+.|....-.
T Consensus        11 l~~~P~g~W~Cp~C~~~~~~   30 (148)
T cd04718          11 LKEVPEGDWICPFCEVEKSG   30 (148)
T ss_pred             CCCCCCCCcCCCCCcCCCCC
Confidence            33556799999999876443


No 35 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=45.86  E-value=8.8  Score=27.99  Aligned_cols=37  Identities=27%  Similarity=0.610  Sum_probs=27.6

Q ss_pred             ccchhhhcCCCCCCCCCCeeccccCccccccccccccCCCCC
Q 032350            3 KFARVICQDKKMSLPGGDWMCAACQHQNFKKREACQRCGYPK   44 (142)
Q Consensus         3 ~~~~~~~~~~~~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~pr   44 (142)
                      .|...|.+.|-+-.     .|.+|+..=|+.|..|..|+.+-
T Consensus        17 ~f~~~l~~~kl~g~-----kC~~CG~v~~PPr~~Cp~C~~~~   53 (140)
T COG1545          17 KFFKGLKEGKLLGT-----KCKKCGRVYFPPRAYCPKCGSET   53 (140)
T ss_pred             HHhhhhhhCcEEEE-----EcCCCCeEEcCCcccCCCCCCCC
Confidence            44444544443322     69999999999999999999983


No 36 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=44.88  E-value=14  Score=20.62  Aligned_cols=32  Identities=25%  Similarity=0.585  Sum_probs=15.5

Q ss_pred             CccccCCCCCCcccccccccCCCCCCCCCCCCCCeeecCCCCCceec
Q 032350           82 NCYRCGAAKTDYACANMMAYGTDGSVPPGWKSGDWICNRMGCGVHNY  128 (142)
Q Consensus        82 ~C~~C~~~~~~~~~~~~~g~g~~~~~~~~~~~gdW~C~~~~C~~~N~  128 (142)
                      .|..||.+-....+             .......+.|+  .|+++.|
T Consensus         2 fC~~CG~~l~~~ip-------------~gd~r~R~vC~--~Cg~IhY   33 (34)
T PF14803_consen    2 FCPQCGGPLERRIP-------------EGDDRERLVCP--ACGFIHY   33 (34)
T ss_dssp             B-TTT--B-EEE---------------TT-SS-EEEET--TTTEEE-
T ss_pred             ccccccChhhhhcC-------------CCCCccceECC--CCCCEEe
Confidence            47888877432211             12335679999  7998865


No 37 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=38.05  E-value=20  Score=21.97  Aligned_cols=13  Identities=23%  Similarity=0.501  Sum_probs=8.3

Q ss_pred             CCCeeccccCccc
Q 032350           18 GGDWMCAACQHQN   30 (142)
Q Consensus        18 ~gdW~C~~C~~~N   30 (142)
                      +-.|.|+.|++.|
T Consensus        42 ~i~y~C~~Cg~~N   54 (54)
T PF10058_consen   42 EIQYRCPYCGALN   54 (54)
T ss_pred             ceEEEcCCCCCcC
Confidence            4467777776655


No 38 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=37.24  E-value=35  Score=21.18  Aligned_cols=25  Identities=24%  Similarity=0.657  Sum_probs=20.1

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCCCCcc
Q 032350           66 YCTAMNCGAHNYASRPNCYRCGAAKTDYA   94 (142)
Q Consensus        66 ~C~~~~C~~~N~~~r~~C~~C~~~~~~~~   94 (142)
                      .|+  .|+....  ...|..||.+-....
T Consensus         7 ~C~--~CgvYTL--k~~CP~CG~~t~~~~   31 (56)
T PRK13130          7 KCP--KCGVYTL--KEICPVCGGKTKNPH   31 (56)
T ss_pred             ECC--CCCCEEc--cccCcCCCCCCCCCC
Confidence            588  9999888  889999998865443


No 39 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=33.48  E-value=34  Score=19.36  Aligned_cols=15  Identities=47%  Similarity=1.017  Sum_probs=9.7

Q ss_pred             CCCeeecCCCCCceecc
Q 032350          113 SGDWICNRMGCGVHNYA  129 (142)
Q Consensus       113 ~gdW~C~~~~C~~~N~a  129 (142)
                      ...|.|.  -|+..|..
T Consensus        22 ~~~w~C~--~C~~~N~l   36 (40)
T PF04810_consen   22 GKTWICN--FCGTKNPL   36 (40)
T ss_dssp             TTEEEET--TT--EEE-
T ss_pred             CCEEECc--CCCCcCCC
Confidence            3579999  79998854


No 40 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=32.93  E-value=59  Score=31.47  Aligned_cols=61  Identities=23%  Similarity=0.578  Sum_probs=44.0

Q ss_pred             CCCCCCCCCCeeccccCccccccccccccCCCCCCCCCCCcccccccccccCCCcccCCCCCCCeecCCCcCccccCCCC
Q 032350           11 DKKMSLPGGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGAHNYASRPNCYRCGAAK   90 (142)
Q Consensus        11 ~~~~~~~~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~~N~~~r~~C~~C~~~~   90 (142)
                      .+.++...+.=.|+.|+..-  ....|..|++.-.                 .-|.|+  .|+-..-.  ..|.+|+...
T Consensus       617 ~g~~eVEVg~RfCpsCG~~t--~~frCP~CG~~Te-----------------~i~fCP--~CG~~~~~--y~CPKCG~El  673 (1121)
T PRK04023        617 KGTIEVEIGRRKCPSCGKET--FYRRCPFCGTHTE-----------------PVYRCP--RCGIEVEE--DECEKCGREP  673 (1121)
T ss_pred             CCceeecccCccCCCCCCcC--CcccCCCCCCCCC-----------------cceeCc--cccCcCCC--CcCCCCCCCC
Confidence            45555666777899999885  4468999998721                 258999  99776443  5699999887


Q ss_pred             CCcc
Q 032350           91 TDYA   94 (142)
Q Consensus        91 ~~~~   94 (142)
                      ....
T Consensus       674 ~~~s  677 (1121)
T PRK04023        674 TPYS  677 (1121)
T ss_pred             Cccc
Confidence            6543


No 41 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=32.16  E-value=25  Score=25.08  Aligned_cols=29  Identities=24%  Similarity=0.550  Sum_probs=23.1

Q ss_pred             CCCCeeccccCccc--cccccccccCCCCCC
Q 032350           17 PGGDWMCAACQHQN--FKKREACQRCGYPKY   45 (142)
Q Consensus        17 ~~gdW~C~~C~~~N--f~~r~~C~~C~~prp   45 (142)
                      +.-.=.||.|+-.-  ..+...|..|++|--
T Consensus        66 kav~V~CP~C~K~TKmLGr~D~CM~C~~pLT   96 (114)
T PF11023_consen   66 KAVQVECPNCGKQTKMLGRVDACMHCKEPLT   96 (114)
T ss_pred             cceeeECCCCCChHhhhchhhccCcCCCcCc
Confidence            34455799998877  778889999999854


No 42 
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=32.15  E-value=38  Score=19.21  Aligned_cols=10  Identities=40%  Similarity=1.491  Sum_probs=8.3

Q ss_pred             CCeeccccCc
Q 032350           19 GDWMCAACQH   28 (142)
Q Consensus        19 gdW~C~~C~~   28 (142)
                      |.|.|..|+.
T Consensus        24 G~~~C~~Cg~   33 (37)
T smart00778       24 GTWFCSVCGA   33 (37)
T ss_pred             cCEEeCCCCC
Confidence            8899988864


No 43 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=31.86  E-value=25  Score=22.65  Aligned_cols=15  Identities=33%  Similarity=0.961  Sum_probs=11.1

Q ss_pred             CCcccCCCCCCCeecCC
Q 032350           63 GDWYCTAMNCGAHNYAS   79 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~   79 (142)
                      +-|.|+  .|+++||.-
T Consensus         3 ~~~kCp--KCgn~~~~e   17 (68)
T COG3478           3 NAFKCP--KCGNTNYEE   17 (68)
T ss_pred             ccccCC--CcCCcchhh
Confidence            457788  888888843


No 44 
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=31.26  E-value=60  Score=28.29  Aligned_cols=44  Identities=18%  Similarity=0.394  Sum_probs=23.7

Q ss_pred             CCCeeccccCccccccccccccCCCCCCCCCCCcccccccccccCCCcccCCCCCCC
Q 032350           18 GGDWMCAACQHQNFKKREACQRCGYPKYGGPDVSTYLCNRTEVLAGDWYCTAMNCGA   74 (142)
Q Consensus        18 ~gdW~C~~C~~~Nf~~r~~C~~C~~prp~~~~~~~~~~~~~~~~~gdW~C~~~~C~~   74 (142)
                      ...|.|..|++.=-...      +-|..+- .++    -.+..-+.||.||  .|+.
T Consensus       423 ~~~~~c~~c~~~yd~~~------g~~~~~~-~~g----t~~~~lp~~~~cp--~c~~  466 (479)
T PRK05452        423 GPRMQCSVCQWIYDPAK------GEPMQDV-APG----TPWSEVPDNFLCP--ECSL  466 (479)
T ss_pred             CCeEEECCCCeEECCCC------CCcccCC-CCC----CChhhCCCCCcCc--CCCC
Confidence            45788888886633211      1111110 111    2466678899999  5553


No 45 
>PHA00626 hypothetical protein
Probab=30.72  E-value=39  Score=21.22  Aligned_cols=11  Identities=36%  Similarity=1.153  Sum_probs=7.4

Q ss_pred             CCcccCCCCCCCe
Q 032350           63 GDWYCTAMNCGAH   75 (142)
Q Consensus        63 gdW~C~~~~C~~~   75 (142)
                      +.+.|+  .|++.
T Consensus        22 nrYkCk--dCGY~   32 (59)
T PHA00626         22 DDYVCC--DCGYN   32 (59)
T ss_pred             cceEcC--CCCCe
Confidence            467777  77764


No 46 
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=30.06  E-value=37  Score=24.66  Aligned_cols=23  Identities=30%  Similarity=0.930  Sum_probs=21.4

Q ss_pred             ccCCCCCCCeecCCCcCccccCCCC
Q 032350           66 YCTAMNCGAHNYASRPNCYRCGAAK   90 (142)
Q Consensus        66 ~C~~~~C~~~N~~~r~~C~~C~~~~   90 (142)
                      .|.  .||..=|+-+..|..|+++-
T Consensus        31 kC~--~CG~v~~PPr~~Cp~C~~~~   53 (140)
T COG1545          31 KCK--KCGRVYFPPRAYCPKCGSET   53 (140)
T ss_pred             EcC--CCCeEEcCCcccCCCCCCCC
Confidence            599  99999999999999999883


No 47 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=29.36  E-value=39  Score=27.25  Aligned_cols=28  Identities=14%  Similarity=0.259  Sum_probs=24.5

Q ss_pred             CCCeeccccCccccccccccccCCCCCC
Q 032350           18 GGDWMCAACQHQNFKKREACQRCGYPKY   45 (142)
Q Consensus        18 ~gdW~C~~C~~~Nf~~r~~C~~C~~prp   45 (142)
                      .-+|.|.+|++.--...-.|..|++.-.
T Consensus       352 ~p~~~c~~cg~~~~~~~~~c~~c~~~~~  379 (389)
T PRK11788        352 KPRYRCRNCGFTARTLYWHCPSCKAWET  379 (389)
T ss_pred             CCCEECCCCCCCCccceeECcCCCCccC
Confidence            5679999999999999999999998643


No 48 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=28.90  E-value=34  Score=19.49  Aligned_cols=12  Identities=33%  Similarity=1.121  Sum_probs=6.9

Q ss_pred             CCCeeecCCCCCce
Q 032350          113 SGDWICNRMGCGVH  126 (142)
Q Consensus       113 ~gdW~C~~~~C~~~  126 (142)
                      .|+..|+  .|+.+
T Consensus        17 ~g~~vC~--~CG~V   28 (43)
T PF08271_consen   17 RGELVCP--NCGLV   28 (43)
T ss_dssp             TTEEEET--TT-BB
T ss_pred             CCeEECC--CCCCE
Confidence            4667777  47654


No 49 
>PF12523 DUF3725:  Protein of unknown function (DUF3725);  InterPro: IPR022199  This domain family is found in viruses, and is approximately 70 amino acids in length. The family is found in association with PF01577 from PFAM. There is a conserved FLE sequence motif. 
Probab=28.20  E-value=30  Score=22.52  Aligned_cols=27  Identities=15%  Similarity=0.465  Sum_probs=20.5

Q ss_pred             hhhhcCCCCCCCCCCeeccccCccccc
Q 032350            6 RVICQDKKMSLPGGDWMCAACQHQNFK   32 (142)
Q Consensus         6 ~~~~~~~~~~~~~gdW~C~~C~~~Nf~   32 (142)
                      ..++++..-.....+|.|..|++.|-.
T Consensus        45 ktmvg~LgYdfe~Elw~Ch~C~~ts~k   71 (74)
T PF12523_consen   45 KTMVGRLGYDFESELWECHSCDNTSTK   71 (74)
T ss_pred             HHHHHHhcCCCccceEEeecCCCchhh
Confidence            456667777777899999999887643


No 50 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=28.06  E-value=29  Score=19.06  Aligned_cols=8  Identities=38%  Similarity=1.028  Sum_probs=4.3

Q ss_pred             ccCCCCCCCe
Q 032350           66 YCTAMNCGAH   75 (142)
Q Consensus        66 ~C~~~~C~~~   75 (142)
                      .|+  .|+..
T Consensus        27 ~C~--~C~~~   34 (38)
T TIGR02098        27 RCG--KCGHV   34 (38)
T ss_pred             ECC--CCCCE
Confidence            455  55544


No 51 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=26.28  E-value=47  Score=19.16  Aligned_cols=9  Identities=33%  Similarity=0.755  Sum_probs=4.1

Q ss_pred             cCccccCCC
Q 032350           81 PNCYRCGAA   89 (142)
Q Consensus        81 ~~C~~C~~~   89 (142)
                      ..|+.||.+
T Consensus        22 ~~Cp~CG~~   30 (46)
T PRK00398         22 VRCPYCGYR   30 (46)
T ss_pred             eECCCCCCe
Confidence            344455443


No 52 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=25.66  E-value=34  Score=24.30  Aligned_cols=22  Identities=27%  Similarity=0.673  Sum_probs=19.8

Q ss_pred             ccccCccccccccccccCCCCC
Q 032350           23 CAACQHQNFKKREACQRCGYPK   44 (142)
Q Consensus        23 C~~C~~~Nf~~r~~C~~C~~pr   44 (142)
                      ||.|+..=-+.+..|..|++.=
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~i   22 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTEI   22 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCEE
Confidence            8999999999999999999854


No 53 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.35  E-value=57  Score=28.65  Aligned_cols=24  Identities=25%  Similarity=0.685  Sum_probs=13.5

Q ss_pred             CcccCCCCCCCeecCCCcCccccCCCC
Q 032350           64 DWYCTAMNCGAHNYASRPNCYRCGAAK   90 (142)
Q Consensus        64 dW~C~~~~C~~~N~~~r~~C~~C~~~~   90 (142)
                      .=.|.  .||+. ..--..|+.|+...
T Consensus       240 ~l~Ch--~Cg~~-~~~~~~Cp~C~s~~  263 (505)
T TIGR00595       240 KLRCH--YCGYQ-EPIPKTCPQCGSED  263 (505)
T ss_pred             eEEcC--CCcCc-CCCCCCCCCCCCCe
Confidence            44566  66644 22335677776653


No 54 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=20.95  E-value=91  Score=17.01  Aligned_cols=6  Identities=50%  Similarity=1.088  Sum_probs=2.5

Q ss_pred             CCCCee
Q 032350           71 NCGAHN   76 (142)
Q Consensus        71 ~C~~~N   76 (142)
                      .|+..|
T Consensus         5 ~Cg~~~   10 (32)
T PF03604_consen    5 ECGAEV   10 (32)
T ss_dssp             SSSSSE
T ss_pred             cCCCee
Confidence            444443


No 55 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=20.81  E-value=82  Score=27.15  Aligned_cols=34  Identities=15%  Similarity=0.288  Sum_probs=0.0

Q ss_pred             cCCCCCCCCCCee-ccccCccccccccccccCCCC
Q 032350           10 QDKKMSLPGGDWM-CAACQHQNFKKREACQRCGYP   43 (142)
Q Consensus        10 ~~~~~~~~~gdW~-C~~C~~~Nf~~r~~C~~C~~p   43 (142)
                      ++........+.. |+.|+......+..|.||++.
T Consensus       210 ~~~~~~~~~~~l~~C~~Cd~l~~~~~a~CpRC~~~  244 (419)
T PRK15103        210 LKPGVTGLRQGLRSCSCCTAILPADQPVCPRCHTK  244 (419)
T ss_pred             ccccCCccccCCCcCCCCCCCCCCCCCCCCCCCCc


No 56 
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=20.52  E-value=75  Score=19.52  Aligned_cols=26  Identities=27%  Similarity=0.646  Sum_probs=16.7

Q ss_pred             CCcccCCCCCCCeecCCCcCccc--cCCCC
Q 032350           63 GDWYCTAMNCGAHNYASRPNCYR--CGAAK   90 (142)
Q Consensus        63 gdW~C~~~~C~~~N~~~r~~C~~--C~~~~   90 (142)
                      +.-+|-  .|..+|-.+++.|.+  ||...
T Consensus        16 ~k~ICr--kCyarl~~~A~nCRKkkCGhsn   43 (52)
T PF01020_consen   16 DKMICR--KCYARLPPRATNCRKKKCGHSN   43 (52)
T ss_dssp             S-EEET--TT--EE-TTSSS-TSSSCTS-S
T ss_pred             cceecc--cccCcCCCCccceecccCCCCc
Confidence            456888  999999999999998  87543


No 57 
>PRK11823 DNA repair protein RadA; Provisional
Probab=20.32  E-value=82  Score=27.19  Aligned_cols=28  Identities=21%  Similarity=0.484  Sum_probs=22.8

Q ss_pred             CCCeeccccCccccccccccccCCCCCC
Q 032350           18 GGDWMCAACQHQNFKKREACQRCGYPKY   45 (142)
Q Consensus        18 ~gdW~C~~C~~~Nf~~r~~C~~C~~prp   45 (142)
                      .-.+.|..|++.-..+.-+|..|++-..
T Consensus         5 ~~~y~C~~Cg~~~~~~~g~Cp~C~~w~t   32 (446)
T PRK11823          5 KTAYVCQECGAESPKWLGRCPECGAWNT   32 (446)
T ss_pred             CCeEECCcCCCCCcccCeeCcCCCCccc
Confidence            4568999999998888888998887554


No 58 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=20.30  E-value=64  Score=26.02  Aligned_cols=30  Identities=27%  Similarity=0.430  Sum_probs=25.0

Q ss_pred             ccCCCcccCCCCCCCeecCCCcCccccCCCCC
Q 032350           60 VLAGDWYCTAMNCGAHNYASRPNCYRCGAAKT   91 (142)
Q Consensus        60 ~~~gdW~C~~~~C~~~N~~~r~~C~~C~~~~~   91 (142)
                      ...-+|.|.  .||+.=-..--.|+.|++--.
T Consensus       350 ~~~p~~~c~--~cg~~~~~~~~~c~~c~~~~~  379 (389)
T PRK11788        350 KRKPRYRCR--NCGFTARTLYWHCPSCKAWET  379 (389)
T ss_pred             hCCCCEECC--CCCCCCccceeECcCCCCccC
Confidence            445579999  999999999999999987643


Done!