Citrus Sinensis ID: 032360

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--

MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

ccCEcccccccHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHccEEEEEEEcccccccccccccccccEEEEEEEccEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEccccccccccc

MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYS*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDWDETCMQMDEVLSSVAETIKNFAVIYLVDISEVPDFNTMYELYDPSTVMFFFRNKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY

Annotation	Function Description	Confidence Level	Reference Protein
Thioredoxin-like protein 4A	Essential role in pre-mRNA splicing.	confident	P83876
Thioredoxin-like protein 4A	Essential role in pre-mRNA splicing.	confident	P83877
Mitosis protein dim1	Plays a fundamental role as a protein essential for entry into mitosis (G2/M progression) as well as for chromosome segregation during mitosis. May play a role in mitotic spindle formation and/or function. May have a role in the maintenance or establishment of the steady-state level of the APC complex.	confident	P87215

No EC number assigned to the protein, probably not an enzyme!

Template: 1QGV, chain A
Confidence level:very confident
Coverage over the Query: 2-138
View the alignment between query and template
View the model in PyMOL