Query         032376
Match_columns 142
No_of_seqs    61 out of 63
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 13:18:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032376.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032376hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0727 Predicted Fe-S-cluster  97.7 4.6E-06   1E-10   60.1  -1.8   57   56-112     8-74  (132)
  2 PF03692 CxxCxxCC:  Putative zi  97.4 0.00011 2.5E-09   48.7   2.4   43   60-112     2-56  (85)
  3 PF14194 Cys_rich_VLP:  Cystein  66.5     4.7  0.0001   27.9   1.9   41   85-135     1-52  (56)
  4 PRK05170 hypothetical protein;  58.9     3.5 7.6E-05   33.0   0.3   36   62-112    25-60  (147)
  5 cd03453 SAV4209_like SAV4209_l  48.9      20 0.00043   25.4   2.8   34   73-108     2-35  (127)
  6 PF11682 DUF3279:  Protein of u  45.6      14 0.00031   28.7   1.7   45   67-120    66-123 (128)
  7 PF13783 DUF4177:  Domain of un  44.0      17 0.00036   23.6   1.6   20   84-103    17-36  (61)
  8 KOG1227 Putative methyltransfe  40.1      13 0.00027   33.6   0.8   18   95-112   152-169 (351)
  9 TIGR00364 exsB protein. This p  35.0      18  0.0004   27.6   0.9   22   46-67    170-195 (201)
 10 PF01355 HIPIP:  High potential  33.6      11 0.00024   25.9  -0.5   12   94-105    52-63  (64)
 11 PRK13693 (3R)-hydroxyacyl-ACP   33.3      51  0.0011   24.5   3.0   37   70-108     9-45  (142)
 12 cd01995 ExsB ExsB is a transcr  31.7      22 0.00048   26.1   0.8   15   53-67    139-157 (169)
 13 cd03449 R_hydratase (R)-hydrat  30.9      31 0.00067   23.4   1.4   34   72-108     3-36  (128)
 14 cd03451 FkbR2 FkbR2 is a Strep  29.3      44 0.00094   23.6   2.0   38   70-108     7-44  (146)
 15 cd00201 WW Two conserved trypt  28.5      39 0.00084   18.4   1.3   13   98-110     1-13  (31)
 16 cd00126 PAH Pancreatic Hormone  27.7      69  0.0015   20.3   2.4   14   83-96     11-24  (36)
 17 PF11123 DNA_Packaging_2:  DNA   26.9      40 0.00087   25.0   1.4   15   87-101    63-77  (82)
 18 PF13186 SPASM:  Iron-sulfur cl  26.5      65  0.0014   19.4   2.2   22  115-138    34-55  (64)
 19 PRK11106 queuosine biosynthesi  26.2      32 0.00069   28.3   0.9   13   55-67    183-200 (231)
 20 COG1141 Fer Ferredoxin [Energy  25.2      26 0.00055   24.6   0.2   17   56-73      6-22  (68)
 21 PF00159 Hormone_3:  Pancreatic  24.6      77  0.0017   20.0   2.2   15   81-95      9-23  (36)
 22 PF12157 DUF3591:  Protein of u  24.5      47   0.001   30.5   1.7   28   69-96    297-326 (457)
 23 PTZ00163 hypothetical protein;  23.3      41 0.00089   28.4   1.1   30   11-40     61-94  (230)
 24 PHA00425 DNA packaging protein  22.9      50  0.0011   24.7   1.3   15   87-101    65-79  (88)
 25 cd03446 MaoC_like MoaC_like     22.6      68  0.0015   22.5   1.9   37   70-108     5-41  (140)
 26 cd03455 SAV4209 SAV4209 is a S  22.4      95  0.0021   21.7   2.6   30   78-108     5-34  (123)
 27 smart00309 PAH Pancreatic horm  21.6 1.1E+02  0.0023   19.5   2.4   14   83-96     11-24  (36)
 28 cd03447 FAS_MaoC FAS_MaoC, the  21.5      70  0.0015   23.2   1.9   26   83-109     9-34  (126)
 29 TIGR03334 IOR_beta indolepyruv  21.2      94   0.002   23.9   2.6   28   78-106    65-92  (189)
 30 PF02064 MAS20:  MAS20 protein   20.1      34 0.00075   26.1   0.0   16   97-112     9-24  (121)

No 1  
>COG0727 Predicted Fe-S-cluster oxidoreductase [General function prediction only]
Probab=97.65  E-value=4.6e-06  Score=60.07  Aligned_cols=57  Identities=21%  Similarity=0.355  Sum_probs=42.8

Q ss_pred             CceeecccCCcccccCCCCCCCCccccC-----C-----ChhHHHHHHHhhCCCcceeeccCCCccc
Q 032376           56 PLWRCVQGCGACCKLDKGPDFATPEEIF-----D-----DPSDVELYRSLIGPDGWCINYEKSTRNC  112 (142)
Q Consensus        56 ~~W~CI~~CGACC~LdP~eR~~~~le~~-----L-----speel~LYlSMVG~DGWCihyDk~tR~C  112 (142)
                      ..|.|-..|||||.....+...++.+..     +     .+.....++.+++-+|||++||+.++.|
T Consensus         8 ~~~~~c~~Cg~cC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~fl~~~~~~C   74 (132)
T COG0727           8 FIFFCCEGCGACCCAIEVSLPEPGFDRGELKGYPADTEALPKYLRCKLLDVDINGRCVFLDGETKLC   74 (132)
T ss_pred             hhhhhHHHhhHHhcCCCCCcchhhhhHHHhcCCCccceeecccceeeeecccCCCCCEEecCCCCce
Confidence            4688899999999988776632222211     1     1445577889999999999999999999


No 2  
>PF03692 CxxCxxCC:  Putative zinc- or iron-chelating domain;  InterPro: IPR005358 This family of proteins contain 8 conserved cysteines that may form a zinc binding site. The function of these proteins is unknown.
Probab=97.40  E-value=0.00011  Score=48.68  Aligned_cols=43  Identities=35%  Similarity=0.827  Sum_probs=29.6

Q ss_pred             ecccCCcccccCCCCCCCCccccCCChhHHHHHHHhhC------------CCcceeeccCCCccc
Q 032376           60 CVQGCGACCKLDKGPDFATPEEIFDDPSDVELYRSLIG------------PDGWCINYEKSTRNC  112 (142)
Q Consensus        60 CI~~CGACC~LdP~eR~~~~le~~Lspeel~LYlSMVG------------~DGWCihyDk~tR~C  112 (142)
                      |.. ||+||+   .      ....|+++|++.+..-.+            .+|+|+.+|..++.|
T Consensus         2 C~~-Cg~CC~---~------~~~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~C~fL~~~~~~C   56 (85)
T PF03692_consen    2 CRQ-CGACCR---G------YRVPLTPEEIERIAEHLGIEEEFFLERYAREDGPCPFLDEDNGRC   56 (85)
T ss_pred             ccc-HhHHHc---C------CCcCCCHHHHHHHHHHhcCchhhhHHHhhccCCCCcCcCCCCCcc
Confidence            666 999999   1      223445555554333222            889999999999999


No 3  
>PF14194 Cys_rich_VLP:  Cysteine-rich VLP
Probab=66.54  E-value=4.7  Score=27.94  Aligned_cols=41  Identities=29%  Similarity=0.646  Sum_probs=30.1

Q ss_pred             ChhHHHHHHHhhCCCcceeeccCCCccc----------hHHhhh-hhhCCCcHHhHHHHHhh
Q 032376           85 DPSDVELYRSLIGPDGWCINYEKSTRNC----------CSDTIK-AIYGSRSKELDTFNCAI  135 (142)
Q Consensus        85 speel~LYlSMVG~DGWCihyDk~tR~C----------CrqqI~-svYG~rS~Em~rF~rai  135 (142)
                      +|+|....+.||-  ++|-|||.  -.|          |.|-|. ++|      =+=|+.||
T Consensus         1 T~~q~r~~~~LV~--~~C~Nyd~--gnCLlLDdge~~~c~q~isys~~------CryFr~AV   52 (56)
T PF14194_consen    1 TPRQRRRIRKLVR--RECCNYDD--GNCLLLDDGECCVCVQSISYSLL------CRYFRAAV   52 (56)
T ss_pred             CHHHHHHHHHHHH--HHcccCCC--CCeEEccCCCCcCccceeeccHH------HHHHHHhh
Confidence            5788888888885  68888888  445          899998 444      45666655


No 4  
>PRK05170 hypothetical protein; Provisional
Probab=58.92  E-value=3.5  Score=32.99  Aligned_cols=36  Identities=28%  Similarity=0.650  Sum_probs=23.6

Q ss_pred             ccCCcccccCCCCCCCCccccCCChhHHHHHHHhhCCCcceeeccCCCccc
Q 032376           62 QGCGACCKLDKGPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKSTRNC  112 (142)
Q Consensus        62 ~~CGACC~LdP~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~tR~C  112 (142)
                      .|||.||.--.++.  ..-+         +|.    -++=|.++|..|.+|
T Consensus        25 DgCG~CCl~KleDe--dtge---------i~~----T~vaC~lLD~~T~~C   60 (147)
T PRK05170         25 DGCGKCCLHKLEDE--DTGE---------IYY----TNVACRLLDIKTCQC   60 (147)
T ss_pred             hhhhHHhceeeecc--CCCc---------EEE----cceecccccCCCCCC
Confidence            58999997433332  1122         222    256799999999999


No 5  
>cd03453 SAV4209_like SAV4209_like.  Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.
Probab=48.86  E-value=20  Score=25.38  Aligned_cols=34  Identities=21%  Similarity=0.276  Sum_probs=26.7

Q ss_pred             CCCCCCccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           73 GPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        73 ~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      ++++ +....-++.+++..|-.++|+.-| ||+|..
T Consensus         2 G~~~-~~~~~~vt~~~i~~fa~~sgD~np-iH~D~~   35 (127)
T cd03453           2 GDEL-PPLTPPVSRADLVRYAGASGDFNP-IHYDED   35 (127)
T ss_pred             CccC-CceeeecCHHHHHHHHHhhcCCCc-cccCHH
Confidence            3444 233456799999999999999999 999954


No 6  
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=45.62  E-value=14  Score=28.74  Aligned_cols=45  Identities=24%  Similarity=0.425  Sum_probs=29.2

Q ss_pred             ccccCCCCCCCCccccCCChhHHHHHHHhhCCC-----------cceeeccCCCccc--hHHhhhhh
Q 032376           67 CCKLDKGPDFATPEEIFDDPSDVELYRSLIGPD-----------GWCINYEKSTRNC--CSDTIKAI  120 (142)
Q Consensus        67 CC~LdP~eR~~~~le~~Lspeel~LYlSMVG~D-----------GWCihyDk~tR~C--CrqqI~sv  120 (142)
                      |.+|||+++         .++-+..-..||.++           =||-++=.+.+.|  |+..|=|+
T Consensus        66 C~yl~pe~k---------~~~ri~~L~~~i~~~~pv~~~~~W~Cv~C~~~Y~GeK~C~~C~tGiYS~  123 (128)
T PF11682_consen   66 CPYLDPEEK---------ERRRIKRLRRMIADLDPVPRKTDWHCVMCGNHYHGEKYCPKCGTGIYSI  123 (128)
T ss_pred             CceECcccc---------hHHHHHHHHHhccccCCCCcCceEEEecCCCccCcCEecCCCCCcccce
Confidence            777777766         122333445666655           3788887888888  88877554


No 7  
>PF13783 DUF4177:  Domain of unknown function (DUF4177)
Probab=44.05  E-value=17  Score=23.59  Aligned_cols=20  Identities=35%  Similarity=0.664  Sum_probs=17.3

Q ss_pred             CChhHHHHHHHhhCCCccee
Q 032376           84 DDPSDVELYRSLIGPDGWCI  103 (142)
Q Consensus        84 Lspeel~LYlSMVG~DGWCi  103 (142)
                      .++++++..+.-.|.|||=.
T Consensus        17 ~~~~~~~~~Ln~~g~eGWeL   36 (61)
T PF13783_consen   17 IDPEDLEEILNEYGKEGWEL   36 (61)
T ss_pred             CCHHHHHHHHHHHHhCCcEE
Confidence            46899999999999999953


No 8  
>KOG1227 consensus Putative methyltransferase [General function prediction only]
Probab=40.13  E-value=13  Score=33.61  Aligned_cols=18  Identities=22%  Similarity=0.477  Sum_probs=16.4

Q ss_pred             hhCCCcceeeccCCCccc
Q 032376           95 LIGPDGWCINYEKSTRNC  112 (142)
Q Consensus        95 MVG~DGWCihyDk~tR~C  112 (142)
                      |+|++|||.|-|-+-+.|
T Consensus       152 L~Gd~gWV~~v~NGI~~~  169 (351)
T KOG1227|consen  152 LYGDLGWVKHVQNGITQI  169 (351)
T ss_pred             ccccccceeehhcCeEEE
Confidence            789999999999988877


No 9  
>TIGR00364 exsB protein. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown.
Probab=34.98  E-value=18  Score=27.62  Aligned_cols=22  Identities=27%  Similarity=0.697  Sum_probs=16.0

Q ss_pred             ccccccccCCCceeecc----cCCcc
Q 032376           46 SVGFGIEKMEPLWRCVQ----GCGAC   67 (142)
Q Consensus        46 ~~gf~~~~~~~~W~CI~----~CGAC   67 (142)
                      .+||....-..+|.|..    +||.|
T Consensus       170 ~~g~~~~~~~~t~sC~~~~~~~CG~C  195 (201)
T TIGR00364       170 ELGVLDLVIKLTYSCYAGGGEGCGKC  195 (201)
T ss_pred             HcCCccccHhhCCcCCCcCCCCCCCC
Confidence            34555445678999986    89988


No 10 
>PF01355 HIPIP:  High potential iron-sulfur protein;  InterPro: IPR000170 High potential iron-sulphur proteins (HiPIP) [, ] are a specific class of high-redox potential 4Fe-4S ferredoxins that functions in anaerobic electron transport and which occurs commonly in purple photosynthetic bacteria and in other bacteria, such as Paracoccus denitrificans and Thiobacillus ferrooxidans []. HiPIPs seem to react by oxidation of [4Fe-4S]2+ to [4Fe-4S]3+ The HiPIPs are small proteins which show significant variation in their sequences, their sizes (from 63 to 85 amino acids), and in their oxidation- reduction potentials. As shown in the following schematic representation the iron-sulphur cluster is bound by four conserved cysteine residues.  [4Fe-4S cluster] | | | | xxxxxxxxxxxxxxxxxxxCxCxxxxxxxCxxxxxCxxxx 'C': conserved cysteine involved in the binding of the iron-sulphur cluster. ; GO: 0009055 electron carrier activity, 0019646 aerobic electron transport chain; PDB: 1ISU_B 1B0Y_A 1CKU_B 1JS2_D 1HRR_A 1NOE_A 1HRQ_A 1NEH_A 1HIP_A 3A38_A ....
Probab=33.57  E-value=11  Score=25.94  Aligned_cols=12  Identities=33%  Similarity=1.232  Sum_probs=7.0

Q ss_pred             HhhCCCcceeec
Q 032376           94 SLIGPDGWCINY  105 (142)
Q Consensus        94 SMVG~DGWCihy  105 (142)
                      -+|.++|||--|
T Consensus        52 k~V~~~GWC~aw   63 (64)
T PF01355_consen   52 KLVNANGWCSAW   63 (64)
T ss_dssp             SBEETT-B-TT-
T ss_pred             ceECCCcccccc
Confidence            378999999654


No 11 
>PRK13693 (3R)-hydroxyacyl-ACP dehydratase subunit HadB; Provisional
Probab=33.32  E-value=51  Score=24.54  Aligned_cols=37  Identities=14%  Similarity=0.183  Sum_probs=29.2

Q ss_pred             cCCCCCCCCccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           70 LDKGPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        70 LdP~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      +.+++++ +.....++++|+.+|-.+.|+.-| ||+|..
T Consensus         9 ~~vG~~~-~~~~~tvt~~di~~FA~~sgD~nP-iH~D~~   45 (142)
T PRK13693          9 VKVGDQL-PEKTYPLTRQDLVNYAGVSGDLNP-IHWDDE   45 (142)
T ss_pred             cCCCCCc-CccceeeCHHHHHHHHHHhCCCCc-cccCHH
Confidence            4567776 344446899999999999998877 889865


No 12 
>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=31.67  E-value=22  Score=26.11  Aligned_cols=15  Identities=40%  Similarity=1.232  Sum_probs=12.0

Q ss_pred             cCCCceeecc----cCCcc
Q 032376           53 KMEPLWRCVQ----GCGAC   67 (142)
Q Consensus        53 ~~~~~W~CI~----~CGAC   67 (142)
                      +-..+|+|..    +||+|
T Consensus       139 ~~~~s~sC~~~~~~~CG~C  157 (169)
T cd01995         139 PLELTWSCYNGGEKHCGEC  157 (169)
T ss_pred             ChhheeeccCCCCCCCCCC
Confidence            3346899987    99999


No 13 
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.  The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer.  A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=30.91  E-value=31  Score=23.42  Aligned_cols=34  Identities=24%  Similarity=0.197  Sum_probs=25.7

Q ss_pred             CCCCCCCccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           72 KGPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        72 P~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      +++.+  .+.-.++++++.+|-.++|++-+ +|||..
T Consensus         3 ~G~~~--~~~~tv~~~~~~~fa~~~gd~np-iH~D~~   36 (128)
T cd03449           3 VGDSA--SLTRTITEEDVELFAELSGDFNP-IHLDEE   36 (128)
T ss_pred             CCCEE--EEEEEEcHHHHHHHHHHhCCCCC-ccCCHH
Confidence            44443  23335799999999999999888 888865


No 14 
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2  has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The function of FkbR2 is unknown.
Probab=29.33  E-value=44  Score=23.62  Aligned_cols=38  Identities=13%  Similarity=0.151  Sum_probs=27.3

Q ss_pred             cCCCCCCCCccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           70 LDKGPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        70 LdP~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      |.++++++....-.++.+++..|-.++|+.-+ +|+|..
T Consensus         7 ~~vG~~~~~~~~~tvt~~~i~~fa~~~gd~~p-iH~D~~   44 (146)
T cd03451           7 FTVGQVFEHAPGRTVTEADNVLFTLLTMNTAP-LHFDAA   44 (146)
T ss_pred             CCCccEEecCCCeEEcHHHHHHHHHhhCCCCc-cccCHH
Confidence            34456653233345899999999999999877 788854


No 15 
>cd00201 WW Two conserved tryptophans domain; also known as the WWP or rsp5 domain; around 40 amino acids; functions as an interaction module in a diverse set of signalling proteins; binds specific proline-rich sequences but at low affinities compared to other peptide recognition proteins such as antibodies and receptors; WW domains have a single groove formed by a conserved Trp and Tyr which recognizes a pair of residues of the sequence X-Pro; variable loops and neighboring domains confer specificity in this domain; there are five distinct groups based on binding: 1) PPXY motifs 2) the PPLP motif; 3) PGM motifs; 4) PSP or PTP motifs; 5) PR motifs.
Probab=28.55  E-value=39  Score=18.39  Aligned_cols=13  Identities=31%  Similarity=0.836  Sum_probs=10.6

Q ss_pred             CCcceeeccCCCc
Q 032376           98 PDGWCINYEKSTR  110 (142)
Q Consensus        98 ~DGWCihyDk~tR  110 (142)
                      ++||-+++|..+|
T Consensus         1 p~~W~~~~~~~g~   13 (31)
T cd00201           1 PPGWEERWDPDGR   13 (31)
T ss_pred             CCCCEEEECCCCC
Confidence            5799999998755


No 16 
>cd00126 PAH Pancreatic Hormone domain, a regulator of pancreatic and gastrointestinal functions; neuropeptide Y (NPY)b, peptide YY (PYY), and pancreatic polypetide (PP) are closely related; propeptide is enzymatically cleaved to yield the mature active peptide with amidated C-terminal ends; receptor binding and activation functions may reside in the N- and C-termini respectively; occurs in neurons, intestinal endocrine cells, and pancreas; exist as monomers and dimers
Probab=27.73  E-value=69  Score=20.28  Aligned_cols=14  Identities=14%  Similarity=0.361  Sum_probs=10.6

Q ss_pred             CCChhHHHHHHHhh
Q 032376           83 FDDPSDVELYRSLI   96 (142)
Q Consensus        83 ~Lspeel~LYlSMV   96 (142)
                      +.+|||++.|++-+
T Consensus        11 ~a~~eel~~Y~~~L   24 (36)
T cd00126          11 DASPEELRQYLAAL   24 (36)
T ss_pred             CCCHHHHHHHHHHH
Confidence            45899999887643


No 17 
>PF11123 DNA_Packaging_2:  DNA packaging protein ;  InterPro: IPR024345  This entry represents Gp18 (gene 18 product), also known as DNA maturase A, from T7-like bacteriophages. In Bacteriophage T3, this protein is required for DNA packaging and functions in a complex with Gp19 [].
Probab=26.95  E-value=40  Score=25.00  Aligned_cols=15  Identities=33%  Similarity=0.831  Sum_probs=12.5

Q ss_pred             hHHHHHHHhhCCCcc
Q 032376           87 SDVELYRSLIGPDGW  101 (142)
Q Consensus        87 eel~LYlSMVG~DGW  101 (142)
                      +-++.|.+|||+||-
T Consensus        63 ~aL~ey~~~~g~~~l   77 (82)
T PF11123_consen   63 AALEEYKKMVGADGL   77 (82)
T ss_pred             HHHHHHHHHcCCCCC
Confidence            447889999999984


No 18 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=26.54  E-value=65  Score=19.39  Aligned_cols=22  Identities=18%  Similarity=0.348  Sum_probs=16.0

Q ss_pred             HhhhhhhCCCcHHhHHHHHhhccC
Q 032376          115 DTIKAIYGSRSKELDTFNCAICSS  138 (142)
Q Consensus       115 qqI~svYG~rS~Em~rF~rai~~~  138 (142)
                      +.|+.|+  .|.++++|.+.+...
T Consensus        34 ~~l~eiw--~s~~~~~~r~~~~~~   55 (64)
T PF13186_consen   34 DSLEEIW--NSPKFREFRKRHKKN   55 (64)
T ss_pred             CCHHHHH--CCHHHHHHHHHHhCC
Confidence            4577777  778888887777665


No 19 
>PRK11106 queuosine biosynthesis protein QueC; Provisional
Probab=26.19  E-value=32  Score=28.27  Aligned_cols=13  Identities=38%  Similarity=1.132  Sum_probs=11.1

Q ss_pred             CCceeecc-----cCCcc
Q 032376           55 EPLWRCVQ-----GCGAC   67 (142)
Q Consensus        55 ~~~W~CI~-----~CGAC   67 (142)
                      ..||+|..     .||.|
T Consensus       183 ~~T~SCy~g~~g~~CG~C  200 (231)
T PRK11106        183 HETLTCYNGIKGDGCGHC  200 (231)
T ss_pred             CceeeccCcCCCCCCCCC
Confidence            67999998     68888


No 20 
>COG1141 Fer Ferredoxin [Energy production and conversion]
Probab=25.19  E-value=26  Score=24.56  Aligned_cols=17  Identities=35%  Similarity=0.862  Sum_probs=14.2

Q ss_pred             CceeecccCCcccccCCC
Q 032376           56 PLWRCVQGCGACCKLDKG   73 (142)
Q Consensus        56 ~~W~CI~~CGACC~LdP~   73 (142)
                      .+|.|| +||+|-..+|+
T Consensus         6 Drd~Ci-gcg~C~~~aPd   22 (68)
T COG1141           6 DRDTCI-GCGACLAVAPD   22 (68)
T ss_pred             chhhcc-ccchhhhcCCc
Confidence            468887 89999998876


No 21 
>PF00159 Hormone_3:  Pancreatic hormone peptide;  InterPro: IPR001955 Pancreatic hormone (PP) [] is a peptide synthesized in pancreatic islets of Langherhans, which acts as a regulator of pancreatic and gastrointestinal functions. The hormone is produced as a larger propeptide, which is enzymatically cleaved to yield the mature active peptide: this is 36 amino acids in length [] and has an amidated C terminus []. The hormone has a globular structure, residues 2-8 forming a left-handed poly-proline-II-like helix, residues 9-13 a beta turn, and 14-32 an alpha-helix,held close to the first helix by hydrophobic interactions []. Unlike glucagon, another peptide hormone, the structure of pancreatic peptide is preserved in aqueous solution []. Both N and C termini are required for activity: receptor binding and activation functions may reside in the N and C termini respectively []. Pancreatic hormone is part of a wider family of active peptides that includes:  Neuropeptide Y (NPY) [], one of the most abundant peptides in the mammalian nervous system. NPY is implicated in the control of feeding and the secretion of the gonadotrophin-releasing hormone. Peptide YY (PYY) []. PPY is a gut peptide that inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibits jejunal and colonic mobility. Various NPY and PYY-like polypeptides from fish and amphibians [, ]. Neuropeptide F (NPF) from invertebrates such as worms and snail. Skin peptide Tyr-Tyr (SPYY) from the frog Phyllomedusa bicolor. SPYY shows a large spectra of antibacterial and antifungal activity.  All these peptides are 36 to 39 amino acids long. Like most active peptides, their C-terminal is amidated and they are synthesized as larger protein precursors.; GO: 0005179 hormone activity, 0005576 extracellular region; PDB: 1LJV_A 1BBA_A 1V1D_A 1PPT_A 2H3T_A 2H4B_A 2BF9_A 2H3S_B 1K8V_A 2DF0_A ....
Probab=24.60  E-value=77  Score=19.98  Aligned_cols=15  Identities=20%  Similarity=0.428  Sum_probs=11.1

Q ss_pred             ccCCChhHHHHHHHh
Q 032376           81 EIFDDPSDVELYRSL   95 (142)
Q Consensus        81 e~~Lspeel~LYlSM   95 (142)
                      .++-+|||+..|++-
T Consensus         9 ~~~aspeel~~Y~~~   23 (36)
T PF00159_consen    9 GDFASPEELAQYYAA   23 (36)
T ss_dssp             STTSSHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHH
Confidence            345699999888764


No 22 
>PF12157 DUF3591:  Protein of unknown function (DUF3591);  InterPro: IPR022591  This functionally uncharacterised domain is found centrally in the eukaryotic transcription initiation factor TFIID subunit 1. 
Probab=24.45  E-value=47  Score=30.50  Aligned_cols=28  Identities=32%  Similarity=0.399  Sum_probs=22.5

Q ss_pred             ccCCCCCCCCccccC--CChhHHHHHHHhh
Q 032376           69 KLDKGPDFATPEEIF--DDPSDVELYRSLI   96 (142)
Q Consensus        69 ~LdP~eR~~~~le~~--Lspeel~LYlSMV   96 (142)
                      .|-|++|.|++.+.-  .+||++-+|-||.
T Consensus       297 ~lk~~~~lp~eeelr~mvtPE~vC~~eSM~  326 (457)
T PF12157_consen  297 VLKPGFRLPDEEELRKMVTPEDVCAYESMQ  326 (457)
T ss_pred             EECCCCCCCCHHHHHhhCCHHHHHHHHHHH
Confidence            488899986665443  6999999999996


No 23 
>PTZ00163 hypothetical protein; Provisional
Probab=23.32  E-value=41  Score=28.44  Aligned_cols=30  Identities=37%  Similarity=0.591  Sum_probs=21.6

Q ss_pred             hhHHHHhhcCchHHhhh----cCCCCccccCCCC
Q 032376           11 NTVVLAAQQRPQRRAKK----LKKPNTKQNNKNS   40 (142)
Q Consensus        11 ~~~~~~a~~~pq~~~~k----~~~~~~k~~~~~~   40 (142)
                      -|-||...+.||+|.+|    +.|.|||+.|.|.
T Consensus        61 ~tsifsgnknpq~r~~k~eee~qkdntk~dndnn   94 (230)
T PTZ00163         61 YTSIFSGNKNPQKRERKNEEENQKDNTKVDNDNN   94 (230)
T ss_pred             HhhhhcCCCChhhccccchhhhccccccccCccc
Confidence            46678888999998776    4566777765543


No 24 
>PHA00425 DNA packaging protein, small subunit
Probab=22.85  E-value=50  Score=24.75  Aligned_cols=15  Identities=33%  Similarity=0.725  Sum_probs=12.5

Q ss_pred             hHHHHHHHhhCCCcc
Q 032376           87 SDVELYRSLIGPDGW  101 (142)
Q Consensus        87 eel~LYlSMVG~DGW  101 (142)
                      +-++-|.++||+||-
T Consensus        65 ~~l~ey~~~~g~d~l   79 (88)
T PHA00425         65 AALEEYKEKVGADGL   79 (88)
T ss_pred             HHHHHHHHhcCCCCC
Confidence            447889999999983


No 25 
>cd03446 MaoC_like MoaC_like    Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain. This protein family has a hot-dog fold similar to that of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.
Probab=22.60  E-value=68  Score=22.48  Aligned_cols=37  Identities=19%  Similarity=0.199  Sum_probs=27.9

Q ss_pred             cCCCCCCCCccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           70 LDKGPDFATPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        70 LdP~eR~~~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      |.++++++ .....++++++..|-.++|+.-+ +|+|..
T Consensus         5 ~~vG~~~~-~~~~tvt~~~i~~fa~~~gD~np-~H~D~~   41 (140)
T cd03446           5 FEIGQVFE-SVGRTVTEADVVMFAGLSGDWNP-IHTDAE   41 (140)
T ss_pred             ccCCCEec-cCCEEECHHHHHHHHHhhCCCcc-cccCHH
Confidence            45566652 23446799999999999999888 788854


No 26 
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The alpha- and gamma-proteobacterial members of this CD have, in addition to a hot dog fold, an N-terminal extension.
Probab=22.40  E-value=95  Score=21.68  Aligned_cols=30  Identities=17%  Similarity=0.093  Sum_probs=24.2

Q ss_pred             CccccCCChhHHHHHHHhhCCCcceeeccCC
Q 032376           78 TPEEIFDDPSDVELYRSLIGPDGWCINYEKS  108 (142)
Q Consensus        78 ~~le~~Lspeel~LYlSMVG~DGWCihyDk~  108 (142)
                      |....-++++++..|-.+.|+.-+ ||+|..
T Consensus         5 ~~~~~~vt~~~i~~fa~~s~D~~p-iH~D~~   34 (123)
T cd03455           5 PRLSIPPDPTLLFRYSAATRDFHR-IHHDRD   34 (123)
T ss_pred             CcEEecCCHHHHHHHHhhcCCCCc-ccCCHH
Confidence            334446799999999999999887 889864


No 27 
>smart00309 PAH Pancreatic hormones / neuropeptide F / peptide YY family. Pancreatic hormone is a regulator of pancreatic and gastrointestinal functions.
Probab=21.63  E-value=1.1e+02  Score=19.47  Aligned_cols=14  Identities=21%  Similarity=0.408  Sum_probs=10.3

Q ss_pred             CCChhHHHHHHHhh
Q 032376           83 FDDPSDVELYRSLI   96 (142)
Q Consensus        83 ~Lspeel~LYlSMV   96 (142)
                      ..+|||+..|++-+
T Consensus        11 ~a~~e~l~~Y~~~L   24 (36)
T smart00309       11 DASPEDLRQYLAAL   24 (36)
T ss_pred             CCCHHHHHHHHHHH
Confidence            45899998887643


No 28 
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and 17-beta-hydroxysteriod dehydrogenase (HSD).
Probab=21.45  E-value=70  Score=23.23  Aligned_cols=26  Identities=19%  Similarity=0.215  Sum_probs=22.5

Q ss_pred             CCChhHHHHHHHhhCCCcceeeccCCC
Q 032376           83 FDDPSDVELYRSLIGPDGWCINYEKST  109 (142)
Q Consensus        83 ~Lspeel~LYlSMVG~DGWCihyDk~t  109 (142)
                      -.+++|+.+|-.+.|+.-| ||+|..-
T Consensus         9 ~~t~~d~~~fa~lsGD~nP-iH~D~~~   34 (126)
T cd03447           9 ITAPASNEPYARVSGDFNP-IHVSRVF   34 (126)
T ss_pred             EEChHHHHHHHHHhCCCCc-cCCCHHH
Confidence            4699999999999999987 8999653


No 29 
>TIGR03334 IOR_beta indolepyruvate ferredoxin oxidoreductase, beta subunit. This model represents the beta subunit of indolepyruvate ferredoxin oxidoreductase, an alpha(2)/beta(2) tetramer, as found in Pyrococcus furiosus and Methanobacterium thermoautotrophicum. Cofactors for the tetramer include TPP, 4Fe4S, and 3Fe-4S. It shows considerable sequence similarity to subunits of several other ketoacid oxidoreductases.
Probab=21.21  E-value=94  Score=23.93  Aligned_cols=28  Identities=14%  Similarity=0.149  Sum_probs=25.6

Q ss_pred             CccccCCChhHHHHHHHhhCCCcceeecc
Q 032376           78 TPEEIFDDPSDVELYRSLIGPDGWCINYE  106 (142)
Q Consensus        78 ~~le~~Lspeel~LYlSMVG~DGWCihyD  106 (142)
                      +++-..|+++++..|+..+.++|..+ +|
T Consensus        65 ~Dilvald~~~~~~~~~~l~~~g~ii-~n   92 (189)
T TIGR03334        65 ADLLLAFEPLEALRYLPYLSEGGEVI-LN   92 (189)
T ss_pred             CCEEEEeCHHHHHHHHHhcCCCcEEE-Ee
Confidence            78888999999999999999999998 44


No 30 
>PF02064 MAS20:  MAS20 protein import receptor;  InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane. Many outer-membrane proteins participate in the early stages of import, four of which (MAS20, MAS22, MAS37 and MAS70) are components of the receptor. MAS20, which forms a subcomplex with MAS22, seems to interact with most or all mitochondrial precursors, suggesting that the protein binds directly to mitochondrial targeting sequences. The MAS37 and MAS70 components also form a subcomplex, the two subcomplexes possibly binding via their trans- membrane (TM) regions - the TM region of MAS70 promotes oligomerisation of attatched protein domains and shares sequence similarity with the TM region of MAS20 []. MAS20 is also known as TOM20.; GO: 0006605 protein targeting, 0006886 intracellular protein transport, 0005742 mitochondrial outer membrane translocase complex; PDB: 3AX3_A 3AWR_B 2V1S_A 3AX5_C 3AX2_C 1OM2_A 2V1T_B.
Probab=20.15  E-value=34  Score=26.06  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=0.0

Q ss_pred             CCCcceeeccCCCccc
Q 032376           97 GPDGWCINYEKSTRNC  112 (142)
Q Consensus        97 G~DGWCihyDk~tR~C  112 (142)
                      +==|.||.||+-.|.=
T Consensus         9 ~~lgYciYFD~KRR~d   24 (121)
T PF02064_consen    9 AFLGYCIYFDYKRRSD   24 (121)
T ss_dssp             ----------------
T ss_pred             HHHHHHhhcccccccC
Confidence            3458999999987753


Done!