BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032385
(142 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|B Chain B, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|C Chain C, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|D Chain D, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|E Chain E, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|F Chain F, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|G Chain G, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
pdb|2OME|H Chain H, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
With Nad(H)
Length = 336
Score = 28.5 bits (62), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 9/69 (13%)
Query: 24 VPDAVIQEALDNLASISQSAQNDNTYKTQATNLLQQTGEQVKNMAQGAGEQVKNMAQGAA 83
+P A ++E D+ + NT+ QA + G +V+++ EQ++ +A GAA
Sbjct: 98 IPSAAVEETADSTICHILNLYRRNTWLYQAL----REGTRVQSV-----EQIREVASGAA 148
Query: 84 HAVKNTLGM 92
TLG+
Sbjct: 149 RIRGETLGL 157
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.304 0.117 0.317
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,031,822
Number of Sequences: 62578
Number of extensions: 95264
Number of successful extensions: 160
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 157
Number of HSP's gapped (non-prelim): 4
length of query: 142
length of database: 14,973,337
effective HSP length: 89
effective length of query: 53
effective length of database: 9,403,895
effective search space: 498406435
effective search space used: 498406435
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 46 (22.3 bits)