BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032385
         (142 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2OME|A Chain A, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|B Chain B, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|C Chain C, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|D Chain D, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|E Chain E, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|F Chain F, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|G Chain G, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
 pdb|2OME|H Chain H, Crystal Structure Of Human Ctbp2 Dehydrogenase Complexed
           With Nad(H)
          Length = 336

 Score = 28.5 bits (62), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 24  VPDAVIQEALDNLASISQSAQNDNTYKTQATNLLQQTGEQVKNMAQGAGEQVKNMAQGAA 83
           +P A ++E  D+      +    NT+  QA     + G +V+++     EQ++ +A GAA
Sbjct: 98  IPSAAVEETADSTICHILNLYRRNTWLYQAL----REGTRVQSV-----EQIREVASGAA 148

Query: 84  HAVKNTLGM 92
                TLG+
Sbjct: 149 RIRGETLGL 157


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.304    0.117    0.317 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,031,822
Number of Sequences: 62578
Number of extensions: 95264
Number of successful extensions: 160
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 157
Number of HSP's gapped (non-prelim): 4
length of query: 142
length of database: 14,973,337
effective HSP length: 89
effective length of query: 53
effective length of database: 9,403,895
effective search space: 498406435
effective search space used: 498406435
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 46 (22.3 bits)