Citrus Sinensis ID: 032390


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADKDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVPEEQVPDHFRGSSRQAILDLNRSLADDPRVQLSHVALGDGITICRRIF
cEEEEEcccccHHHHHHHHHHccccccEEEEEccHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHccccccEEEEEccccccCEcccccccccccccHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEcc
MITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADKDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVPEEQVPDHFRGSSRQAILDLNRSLADDPRVQLSHVALGDGITICRRIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITAIDVNRETYEIGLPIIKKAGVDHKINFIESEALSVLDQLLKYSENEGSFDYAFVDADKDNYCNYHERLMKLLKVGGIAVYDNTLWGGTVAVPEEQVPDHFRGSSRQAILDLNRSLADDPRVQLSHVALGDGITICRRIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable caffeoyl-CoA O-methyltransferase At4g26220 Methylates caffeoyl-CoA to feruloyl-CoA and 5-hydroxyferuloyl-CoA to sinapoyl-CoA. Plays a role in the synthesis of feruloylated polysaccharides. Involved in the reinforcement of the plant cell wall. Also involved in the responding to wounding or pathogen challenge by the increased formation of cell wall-bound ferulic acid polymers.probableQ9C5D7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C3Y, chain A
Confidence level:very confident
Coverage over the Query: 1-142
View the alignment between query and template
View the model in PyMOL