BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032416
(141 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4F1N|A Chain A, Crystal Structure Of Kluyveromyces Polysporus Argonaute
With A Guide Rna
pdb|4F1N|B Chain B, Crystal Structure Of Kluyveromyces Polysporus Argonaute
With A Guide Rna
Length = 1046
Score = 31.6 bits (70), Expect = 0.16, Method: Composition-based stats.
Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 11/88 (12%)
Query: 53 RAKPLEPRQQLKPKKVYFLVELPKLPDEEKITRRVRSGIQMSAKDRLECLMLSRRAVSDL 112
R KP+ P++ KPKK Y L+E L DE++I + R I + +D + S + +
Sbjct: 86 RGKPVPPQELSKPKK-YELIE--ALLDEDEILYKYRDRIAFNGEDTI----YSHVPLEEF 138
Query: 113 TAVN----VRSSHGSEVAPGTGDGSDEG 136
T + V + +V PG G S++
Sbjct: 139 TLFDGCWEVSNKQKKKVVPGMGAPSNKA 166
>pdb|3CT4|A Chain A, Structure Of Dha-Kinase Subunit Dhak From L. Lactis
pdb|3CT4|B Chain B, Structure Of Dha-Kinase Subunit Dhak From L. Lactis
pdb|3CT4|C Chain C, Structure Of Dha-Kinase Subunit Dhak From L. Lactis
Length = 332
Score = 26.6 bits (57), Expect = 4.4, Method: Compositional matrix adjust.
Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 3/85 (3%)
Query: 37 PGYVLLDSEAVKHFGIRAKPLEPRQQLKPKKVYFLVELPKLPDEEKITRRVRSGIQ---M 93
PG+VL D+E GI ++P R+++K + KL +E K + GI M
Sbjct: 204 PGFVLDDNEIEYGVGIHSEPGYRREKMKTSYELATELVGKLKEEFKFEAGQKYGILVNGM 263
Query: 94 SAKDRLECLMLSRRAVSDLTAVNVR 118
A +E + LT N+
Sbjct: 264 GATPLMEQFIFMNDVAKLLTEENIE 288
>pdb|2P7K|A Chain A, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
(Hexagonal Form)
pdb|2P7K|B Chain B, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
(Hexagonal Form)
pdb|2P7L|A Chain A, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7L|B Chain B, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7L|C Chain C, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7L|D Chain D, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7L|E Chain E, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7L|F Chain F, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 5.75
pdb|2P7M|A Chain A, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7M|B Chain B, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7M|C Chain C, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7M|D Chain D, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7M|E Chain E, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7M|F Chain F, Crystal Structure Of Monoclinic Form Of Genomically
Encoded Fosfomycin Resistance Protein, Fosx, From
Listeria Monocytogenes At Ph 6.5
pdb|2P7O|A Chain A, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
(Tetragonal Form)
pdb|2P7O|B Chain B, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
(Tetragonal Form)
pdb|2P7P|A Chain A, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
pdb|2P7P|B Chain B, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
pdb|2P7P|C Chain C, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
pdb|2P7P|D Chain D, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
pdb|2P7P|E Chain E, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
pdb|2P7P|F Chain F, Crystal Structure Of Genomically Encoded Fosfomycin
Resistance Protein, Fosx, From Listeria Monocytogenes
Complexed With Mn(Ii) And Sulfate Ion
Length = 133
Score = 25.8 bits (55), Expect = 7.6, Method: Compositional matrix adjust.
Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
Query: 44 SEAVKHFGIRAKPLEPRQQLKPKKVYF------LVELPKLPDEEKITR 85
+E +K G+ KP PR Q + + +YF L EL EE++ R
Sbjct: 83 TERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEERLKR 130
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.313 0.133 0.366
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,083,713
Number of Sequences: 62578
Number of extensions: 141110
Number of successful extensions: 240
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 235
Number of HSP's gapped (non-prelim): 8
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)