Citrus Sinensis ID: 032419


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKDMKNYNRRQAEGTKPEEEEESEKSMSEVNDEDDDEEGSGG
cccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcccccccccccccccccc
****************************************PASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYVAKAEKRKVEYEKD***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGGKSKSDTRNAKLSVNKKPAKAGRKSGKAAKDPNKPKRPASAFFVFMEEFREQYKKDHPKNKSVAAVGKAGGEKWKSMSEADKAPYxxxxxxxxxxxxxxxxxxxxxQAEGTKPEEEEESEKSMSEVNDEDDDEEGSGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
High mobility group B protein 3 Binds preferentially double-stranded DNA.confidentP93047
High mobility group B protein 2 Binds preferentially double-stranded DNA. Confers sensitivity to salt and drought stresses.probableO49596
HMG1/2-like protein probableP40619

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRQ, chain A
Confidence level:very confident
Coverage over the Query: 29-109
View the alignment between query and template
View the model in PyMOL