BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032435
(141 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2K4E|A Chain A, Solution Structure Of The Hiv-2 Unmyristoylated Matrix
Protein
pdb|2K4H|A Chain A, Solution Structure Of The Hiv-2 Myristoylated Matrix
Protein
pdb|2K4I|A Chain A, Solution Structure Of Hiv-2 Myrma Bound To Di-C4-Pi(4,5)p2
Length = 134
Score = 26.6 bits (57), Expect = 4.8, Method: Compositional matrix adjust.
Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 8/67 (11%)
Query: 74 DRLGLIGLGFAGIVALWASVNLITAIDKLPIIPNALELIGILFSTVSVIEIIIWHGCCEW 133
++L GL + + + ++T +D P++P E + LF+TV V IW C
Sbjct: 38 NKLDRFGLAESLLESKEGCQKILTVLD--PMVPTGSENLKSLFNTVCV----IW--CIHA 89
Query: 134 EKKIKES 140
E+K+K++
Sbjct: 90 EEKVKDT 96
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.140 0.434
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,496,280
Number of Sequences: 62578
Number of extensions: 105546
Number of successful extensions: 172
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 172
Number of HSP's gapped (non-prelim): 1
length of query: 141
length of database: 14,973,337
effective HSP length: 89
effective length of query: 52
effective length of database: 9,403,895
effective search space: 489002540
effective search space used: 489002540
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 46 (22.3 bits)