Citrus Sinensis ID: 032441


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MSSEAAATKGGRGRSKDTKPVSRSHKAGLQFPVGRVARFLKKGRYAQRVGSGSPVYLSAVLEYLAAEVLELAGNAARDNKKNRIIPRHIQLAVKNDEEFSKLLGSVTIANGGVLPNIHQNLLPKKAAARKGEIGSVSQEF
cccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHcHHcccEEcccccccccccccccccccccccccccccccc
****************************LQFPVGRVARFLKKGRYAQRVGSGSPVYLSAVLEYLAAEVLELAGNAARDNKKNRIIPRHIQLAVKNDEEFSKLLGSVTIANGGVLPNIHQNLL******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSEAAATKGGRGRSKDTKPVSRSHKAGLQFPVGRVARFLKKGRYAQRVGSGSPVYLSAVLEYLAAEVLELAGNAARDNKKNRIIPRHIQLAVKNDEEFSKLLGSVTIANGGVLPNIHQNLLPKKAAARKGEIGSVSQEF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone H2A.1 Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.confidentQ6BKW8
Histone H2A Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.confidentQ875B8
Histone H2A Core component of nucleosome which plays a central role in DNA double strand break (DSB) repair. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.confidentQ6CK59

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F8N, chain K
Confidence level:very confident
Coverage over the Query: 29-124
View the alignment between query and template
View the model in PyMOL