Citrus Sinensis ID: 032446

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MATFSAITSVIFAPSLEPSFSNNVIAERTSNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEENSQNITTVQEAADLIEKLVEKKAA
ccccccHHHHHccccccccccccccHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcc
*******************************************FPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEENSQNITTVQEAADLIE*LV*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATFSAITSVIFAPSLEPSFSNNVIAERTSNLKMAIGGWRKNSFPSLKTNRFCVSCSAKPETVQKVCEIVRRQLALPAETELTSESKFSALGADSLDTVEIVMSLEEEFGIGVEEENSQNITTVQEAADLIEKLVEKKAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl carrier protein 4, chloroplastic Carrier of the growing fatty acid chain in fatty acid biosynthesis that plays a major role in the biosynthesis of fatty acids in leaves. Required for the biosynthesis of chloroplast photosynthetic membrane lipids such as monogalactosyldiacylglycerol, digalactosyldiacylglycerol and phosphatidylglycerol. Is essential for the biosynthesis of the cuticular wax and cutin polymers in leaves, and for the establishment of systemic acquired resistance (SAR).probableQ9SW21
Acyl carrier protein 3, chloroplastic Carrier of the growing fatty acid chain in fatty acid biosynthesis.probableP15543
Acyl carrier protein 2, chloroplastic Carrier of the growing fatty acid chain in fatty acid biosynthesis.probableP23235

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AVA, chain A
Confidence level:very confident
Coverage over the Query: 58-139
View the alignment between query and template
View the model in PyMOL