Query         032449
Match_columns 140
No_of_seqs    110 out of 625
Neff          5.9 
Searched_HMMs 46136
Date          Fri Mar 29 14:14:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032449.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032449hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1984 Vesicle coat complex C 100.0 4.3E-35 9.3E-40  265.2   8.4  107   18-124   268-374 (1007)
  2 COG5028 Vesicle coat complex C 100.0 1.6E-30 3.4E-35  233.6   5.5  104   19-125   133-236 (861)
  3 KOG1985 Vesicle coat complex C  99.9 4.1E-27 8.8E-32  212.8   4.8   91   31-124   164-254 (887)
  4 PLN00162 transport protein sec  99.9 4.7E-26   1E-30  207.9   8.2   86   35-127     7-92  (761)
  5 PTZ00395 Sec24-related protein  99.9   6E-25 1.3E-29  206.3   3.8  125    5-134   623-756 (1560)
  6 KOG1986 Vesicle coat complex C  99.8 2.7E-20 5.9E-25  166.6   2.9   97   33-136     5-101 (745)
  7 COG5047 SEC23 Vesicle coat com  99.7 1.1E-18 2.5E-23  154.2   3.7   97   34-137     6-103 (755)
  8 PF04810 zf-Sec23_Sec24:  Sec23  99.7 5.4E-19 1.2E-23  106.8   1.0   39   87-125     1-39  (40)
  9 COG2888 Predicted Zn-ribbon RN  90.3    0.11 2.3E-06   34.0   0.5   32   78-119    28-59  (61)
 10 TIGR01053 LSD1 zinc finger dom  89.2    0.35 7.6E-06   27.5   2.0   29   89-121     2-30  (31)
 11 PF13719 zinc_ribbon_5:  zinc-r  88.5    0.31 6.8E-06   28.4   1.6   33   88-120     2-35  (37)
 12 PF10058 DUF2296:  Predicted in  88.2    0.37   8E-06   30.7   1.9   34   87-120    21-54  (54)
 13 PF09082 DUF1922:  Domain of un  87.8    0.37   8E-06   32.3   1.8   30   88-123     3-32  (68)
 14 PRK00398 rpoP DNA-directed RNA  85.7    0.63 1.4E-05   28.1   1.8   31   88-122     3-33  (46)
 15 PRK14890 putative Zn-ribbon RN  83.9     0.5 1.1E-05   30.8   0.8   28   82-119    30-57  (59)
 16 smart00661 RPOL9 RNA polymeras  83.1    0.74 1.6E-05   28.0   1.4   32   90-123     2-33  (52)
 17 PF02318 FYVE_2:  FYVE-type zin  80.2     1.3 2.7E-05   32.0   1.9   32   88-119    71-103 (118)
 18 PRK03954 ribonuclease P protei  79.1     1.4 2.9E-05   32.6   1.8   37   89-125    65-108 (121)
 19 PF13717 zinc_ribbon_4:  zinc-r  78.0     1.4   3E-05   25.6   1.3   32   88-119     2-34  (36)
 20 PF09723 Zn-ribbon_8:  Zinc rib  75.8     1.3 2.9E-05   26.4   0.8   30   89-119     6-35  (42)
 21 COG5415 Predicted integral mem  74.0       2 4.3E-05   35.0   1.6   51   88-138   192-245 (251)
 22 PF08271 TF_Zn_Ribbon:  TFIIB z  73.7     3.9 8.5E-05   24.2   2.5   27   90-119     2-28  (43)
 23 PRK12380 hydrogenase nickel in  73.3     2.3   5E-05   30.6   1.7   28   87-120    69-96  (113)
 24 cd00350 rubredoxin_like Rubred  73.3     2.2 4.8E-05   24.1   1.3   24   90-119     3-26  (33)
 25 TIGR02605 CxxC_CxxC_SSSS putat  72.2     1.9 4.2E-05   26.3   0.9   31   89-120     6-36  (52)
 26 TIGR00100 hypA hydrogenase nic  72.1     2.6 5.6E-05   30.4   1.7   28   87-120    69-96  (115)
 27 PF11781 RRN7:  RNA polymerase   71.9       3 6.5E-05   24.3   1.6   27   88-119     8-34  (36)
 28 PF10122 Mu-like_Com:  Mu-like   71.7     1.5 3.2E-05   27.8   0.3   36   89-126     5-40  (51)
 29 cd00730 rubredoxin Rubredoxin;  70.9     1.6 3.5E-05   27.3   0.4   30   90-119     3-43  (50)
 30 PF08792 A2L_zn_ribbon:  A2L zi  69.2     7.1 0.00015   22.3   2.8   30   87-120     2-31  (33)
 31 PF09779 Ima1_N:  Ima1 N-termin  69.2     3.1 6.7E-05   30.7   1.6   34   89-124     1-34  (131)
 32 PRK03681 hypA hydrogenase nick  68.7     3.5 7.6E-05   29.7   1.8   29   87-120    69-97  (114)
 33 PRK12722 transcriptional activ  68.6     2.2 4.8E-05   33.7   0.8   31   85-118   131-162 (187)
 34 smart00834 CxxC_CXXC_SSSS Puta  68.5     2.5 5.3E-05   24.3   0.8   29   89-118     6-34  (41)
 35 COG1096 Predicted RNA-binding   66.1     3.7 8.1E-05   32.5   1.6   27   88-120   149-175 (188)
 36 PF14803 Nudix_N_2:  Nudix N-te  64.1     2.2 4.8E-05   24.6  -0.0   29   91-119     3-31  (34)
 37 COG1996 RPC10 DNA-directed RNA  62.8     4.2 9.1E-05   25.5   1.1   31   88-122     6-36  (49)
 38 PF07282 OrfB_Zn_ribbon:  Putat  62.8     5.3 0.00012   25.6   1.6   29   88-120    28-56  (69)
 39 PF07754 DUF1610:  Domain of un  61.5     7.3 0.00016   20.9   1.7   24   91-118     1-24  (24)
 40 PF13240 zinc_ribbon_2:  zinc-r  61.0     3.7 8.1E-05   21.5   0.5   21   90-118     1-21  (23)
 41 smart00132 LIM Zinc-binding do  60.8     7.7 0.00017   21.2   1.9   29   90-118     1-35  (39)
 42 PF12760 Zn_Tnp_IS1595:  Transp  59.6      11 0.00024   22.6   2.5   27   89-118    19-45  (46)
 43 PF00641 zf-RanBP:  Zn-finger i  59.0     3.1 6.8E-05   22.7   0.0   13  110-122     4-16  (30)
 44 PRK00564 hypA hydrogenase nick  58.9     4.2 9.1E-05   29.4   0.7   29   87-120    70-98  (117)
 45 TIGR00311 aIF-2beta translatio  58.6      16 0.00035   27.2   3.8   33   88-123    97-131 (133)
 46 PF01927 Mut7-C:  Mut7-C RNAse   57.5     8.1 0.00018   28.7   2.0   33   88-120    91-134 (147)
 47 PF06943 zf-LSD1:  LSD1 zinc fi  57.5      11 0.00023   20.5   1.9   24   91-118     1-24  (25)
 48 TIGR01384 TFS_arch transcripti  56.1     7.6 0.00016   26.9   1.6   27   90-122     2-28  (104)
 49 PF02891 zf-MIZ:  MIZ/SP-RING z  55.7    0.86 1.9E-05   28.3  -3.0   32   87-118    14-49  (50)
 50 PF00301 Rubredoxin:  Rubredoxi  55.6     3.1 6.7E-05   25.7  -0.4   30   90-119     3-43  (47)
 51 TIGR02098 MJ0042_CXXC MJ0042 f  54.8     9.8 0.00021   21.6   1.7   31   89-119     3-34  (38)
 52 COG2956 Predicted N-acetylgluc  54.6     7.4 0.00016   33.8   1.5   36   86-129   352-387 (389)
 53 PF13894 zf-C2H2_4:  C2H2-type   53.5     6.9 0.00015   19.0   0.8   10  111-120     1-10  (24)
 54 PF13408 Zn_ribbon_recom:  Reco  53.5     8.8 0.00019   23.3   1.4   32   86-118     3-34  (58)
 55 PRK00432 30S ribosomal protein  52.6     7.5 0.00016   24.2   1.0   25   89-119    21-46  (50)
 56 COG0675 Transposase and inacti  52.4     7.8 0.00017   30.9   1.3   24   88-120   309-332 (364)
 57 PF04032 Rpr2:  RNAse P Rpr2/Rp  52.3     9.7 0.00021   25.1   1.6   31   88-118    46-85  (85)
 58 cd00729 rubredoxin_SM Rubredox  52.2     7.5 0.00016   22.2   0.8   11  110-120     2-12  (34)
 59 smart00401 ZnF_GATA zinc finge  51.6     7.4 0.00016   24.2   0.8   32   88-119     3-34  (52)
 60 COG1592 Rubrerythrin [Energy p  51.1     8.4 0.00018   29.9   1.2   14  107-120   131-144 (166)
 61 PF13831 PHD_2:  PHD-finger; PD  51.0     2.3 5.1E-05   24.7  -1.4   32   86-117     2-36  (36)
 62 PF06827 zf-FPG_IleRS:  Zinc fi  50.1       9 0.00019   20.8   0.9   27   90-118     3-29  (30)
 63 KOG2846 Predicted membrane pro  49.6      12 0.00027   32.0   2.1   36   88-123   220-255 (328)
 64 smart00659 RPOLCX RNA polymera  49.3      16 0.00034   22.1   2.0   25   90-119     4-28  (44)
 65 TIGR00416 sms DNA repair prote  49.1     8.7 0.00019   33.9   1.2   30   87-124     6-35  (454)
 66 PRK03824 hypA hydrogenase nick  48.4      12 0.00026   27.7   1.6   34   87-120    69-117 (135)
 67 smart00547 ZnF_RBZ Zinc finger  48.2     7.1 0.00015   20.4   0.3   13  110-122     2-14  (26)
 68 PF12773 DZR:  Double zinc ribb  48.1     7.1 0.00015   23.4   0.3   30   87-121    11-40  (50)
 69 PRK00762 hypA hydrogenase nick  48.0     9.2  0.0002   27.9   1.0   33   87-120    69-102 (124)
 70 PRK12860 transcriptional activ  47.6     9.4  0.0002   30.3   1.0   30   85-117   131-161 (189)
 71 PF05280 FlhC:  Flagellar trans  46.5       7 0.00015   30.4   0.1   31   85-118   131-162 (175)
 72 PF10571 UPF0547:  Uncharacteri  46.3     8.1 0.00018   20.9   0.4   23   90-120     2-24  (26)
 73 PRK11823 DNA repair protein Ra  46.2     9.6 0.00021   33.4   1.0   29   88-124     7-35  (446)
 74 cd02342 ZZ_UBA_plant Zinc fing  46.0      14  0.0003   22.6   1.4   22   89-117     1-22  (43)
 75 COG2051 RPS27A Ribosomal prote  43.7      27 0.00058   23.3   2.5   33   88-123    19-51  (67)
 76 PF03604 DNA_RNApol_7kD:  DNA d  43.2      16 0.00034   20.8   1.3   13   85-97     14-26  (32)
 77 COG2023 RPR2 RNase P subunit R  42.3      14 0.00031   26.6   1.2   37   89-125    57-97  (105)
 78 PF00320 GATA:  GATA zinc finge  42.3     8.1 0.00018   22.2  -0.1   28   91-118     1-28  (36)
 79 PF12874 zf-met:  Zinc-finger o  42.2      15 0.00033   18.5   1.0   10  111-120     1-10  (25)
 80 PF14353 CpXC:  CpXC protein     41.2      28 0.00061   24.9   2.6   23   87-109    37-62  (128)
 81 PF02150 RNA_POL_M_15KD:  RNA p  40.3      27 0.00059   19.9   2.0   30   90-122     3-32  (35)
 82 PRK06393 rpoE DNA-directed RNA  39.7      17 0.00036   24.0   1.1   23   88-120     5-27  (64)
 83 PRK03988 translation initiatio  38.8      53  0.0011   24.6   3.9   34   88-124   102-137 (138)
 84 KOG3799 Rab3 effector RIM1 and  37.1      21 0.00045   27.3   1.5   31   87-121    88-118 (169)
 85 COG0375 HybF Zn finger protein  36.9      25 0.00054   25.7   1.8   28   87-120    69-96  (115)
 86 PRK14810 formamidopyrimidine-D  36.3      32 0.00069   28.2   2.5   28   89-118   245-272 (272)
 87 PF00130 C1_1:  Phorbol esters/  36.3      28  0.0006   20.9   1.7   29   86-119     9-37  (53)
 88 smart00249 PHD PHD zinc finger  35.8      23  0.0005   19.8   1.2   31   86-116    12-47  (47)
 89 PF15288 zf-CCHC_6:  Zinc knuck  35.5      14  0.0003   22.2   0.2   11   89-99      2-12  (40)
 90 PRK08270 anaerobic ribonucleos  35.0      18 0.00039   33.6   1.0   25   86-119   624-648 (656)
 91 PF05129 Elf1:  Transcription e  34.6      14 0.00031   25.1   0.2   14  109-122    21-34  (81)
 92 PRK12336 translation initiatio  34.6      57  0.0012   25.7   3.6   33   88-123    98-132 (201)
 93 PF10263 SprT-like:  SprT-like   34.5      23  0.0005   25.8   1.3   31   86-118   121-151 (157)
 94 COG4888 Uncharacterized Zn rib  33.9      20 0.00043   25.9   0.8   14  109-122    21-34  (104)
 95 PF13453 zf-TFIIB:  Transcripti  33.2      29 0.00063   20.2   1.4   11   87-97     18-28  (41)
 96 PRK05580 primosome assembly pr  33.1      52  0.0011   30.5   3.6   38   88-125   381-423 (679)
 97 PF01155 HypA:  Hydrogenase exp  32.6      14  0.0003   26.5  -0.2   28   87-120    69-96  (113)
 98 PRK11827 hypothetical protein;  32.5      41 0.00089   21.8   2.1   33   87-123     7-39  (60)
 99 cd02338 ZZ_PCMF_like Zinc fing  31.9      26 0.00056   21.4   1.0   22   89-117     1-22  (49)
100 PF00412 LIM:  LIM domain;  Int  31.5      73  0.0016   19.0   3.1   28   88-116    26-53  (58)
101 PF13597 NRDD:  Anaerobic ribon  31.3      27 0.00059   31.6   1.5   26   86-120   489-514 (546)
102 PHA00626 hypothetical protein   31.3      48   0.001   21.5   2.2   30   86-125     9-38  (59)
103 PF08274 PhnA_Zn_Ribbon:  PhnA   31.0      26 0.00057   19.6   0.9   27   88-119     2-28  (30)
104 PF08879 WRC:  WRC;  InterPro:   30.9      23  0.0005   21.8   0.7    9  106-114    10-18  (46)
105 PRK08351 DNA-directed RNA poly  30.8      24 0.00052   23.0   0.8   21   90-120     5-25  (61)
106 PRK14811 formamidopyrimidine-D  30.7      57  0.0012   26.7   3.1   32   90-123   237-268 (269)
107 cd02340 ZZ_NBR1_like Zinc fing  30.1      38 0.00082   20.2   1.5   21   89-117     1-21  (43)
108 PRK01103 formamidopyrimidine/5  30.0      50  0.0011   26.9   2.7   27   90-118   247-273 (274)
109 PRK08271 anaerobic ribonucleos  29.3      23  0.0005   32.8   0.7   27   86-120   564-590 (623)
110 PRK12286 rpmF 50S ribosomal pr  29.3      43 0.00093   21.3   1.8   26   86-120    25-50  (57)
111 TIGR00686 phnA alkylphosphonat  28.8      50  0.0011   24.0   2.2   29   88-121     2-30  (109)
112 PRK08402 replication factor A;  28.3      43 0.00094   28.8   2.1   44   87-136   211-262 (355)
113 TIGR01031 rpmF_bact ribosomal   27.9      41  0.0009   21.2   1.5   24   87-119    25-48  (55)
114 TIGR00595 priA primosomal prot  27.9      54  0.0012   29.2   2.8   20  106-125   236-255 (505)
115 smart00778 Prim_Zn_Ribbon Zinc  27.8      66  0.0014   18.8   2.2   12  107-118    22-33  (37)
116 PRK07111 anaerobic ribonucleos  27.7      30 0.00065   32.6   1.1   25   86-119   678-702 (735)
117 KOG3399 Predicted Yippee-type   27.7      23  0.0005   26.3   0.3   25   87-113    14-38  (122)
118 PF06397 Desulfoferrod_N:  Desu  27.4      29 0.00063   20.3   0.6   13  108-120     4-16  (36)
119 KOG2169 Zn-finger transcriptio  27.1      30 0.00065   32.0   1.0   42   86-127   317-362 (636)
120 PRK00420 hypothetical protein;  27.1      39 0.00084   24.6   1.4   29   89-122    24-52  (112)
121 PF05907 DUF866:  Eukaryotic pr  26.9      51  0.0011   25.2   2.1   35   88-122    30-76  (161)
122 PF00569 ZZ:  Zinc finger, ZZ t  26.9      53  0.0012   19.6   1.8   22   89-117     5-26  (46)
123 PRK00415 rps27e 30S ribosomal   26.5      81  0.0018   20.5   2.7   33   88-123    11-43  (59)
124 PRK07218 replication factor A;  25.9      34 0.00074   30.2   1.1   27   86-122   295-321 (423)
125 COG4416 Com Mu-like prophage p  25.8      12 0.00026   24.2  -1.3   33   88-122     4-36  (60)
126 PF13465 zf-H2C2_2:  Zinc-finge  25.7      43 0.00093   17.5   1.1   12  108-119    12-23  (26)
127 KOG4784 Uncharacterized conser  25.7      24 0.00052   30.5   0.1   35   85-120   181-215 (348)
128 cd04476 RPA1_DBD_C RPA1_DBD_C:  25.6      57  0.0012   24.2   2.2   27   88-120    34-61  (166)
129 PHA02942 putative transposase;  25.5      43 0.00092   28.9   1.6   29   87-120   324-352 (383)
130 PF02591 DUF164:  Putative zinc  25.4      21 0.00046   22.1  -0.2   29   90-118    24-54  (56)
131 PRK13130 H/ACA RNA-protein com  25.1      77  0.0017   20.3   2.4   27   87-123     4-30  (56)
132 COG1773 Rubredoxin [Energy pro  25.1      42  0.0009   21.5   1.1   17  102-118    28-44  (55)
133 cd00202 ZnF_GATA Zinc finger D  24.9      15 0.00032   23.1  -1.0   28   91-118     2-29  (54)
134 PRK13945 formamidopyrimidine-D  24.6      65  0.0014   26.5   2.5   26   90-117   256-281 (282)
135 PF14692 DUF4462:  Domain of un  24.6      26 0.00056   19.5   0.1   13   41-53      5-17  (28)
136 COG1198 PriA Primosomal protei  24.6      96  0.0021   29.4   3.8   43   86-132   442-484 (730)
137 KOG1074 Transcriptional repres  24.4      31 0.00066   33.3   0.6   42   82-123   347-394 (958)
138 smart00290 ZnF_UBP Ubiquitin C  23.8      57  0.0012   19.2   1.5   21   90-120     1-21  (50)
139 COG1594 RPB9 DNA-directed RNA   23.6      52  0.0011   23.7   1.5   34   89-124     3-36  (113)
140 PF09788 Tmemb_55A:  Transmembr  23.5 1.3E+02  0.0027   25.1   3.9   38   85-124    62-99  (256)
141 PRK04351 hypothetical protein;  23.5      84  0.0018   23.7   2.7   31   87-119   111-141 (149)
142 PF00096 zf-C2H2:  Zinc finger,  23.5      49  0.0011   16.1   1.0   10  111-120     1-10  (23)
143 TIGR00354 polC DNA polymerase,  23.5      43 0.00093   32.9   1.3   27   86-122   623-649 (1095)
144 PF05715 zf-piccolo:  Piccolo Z  23.2      37 0.00081   22.2   0.6   19  109-128    29-47  (61)
145 COG0266 Nei Formamidopyrimidin  23.1      58  0.0013   27.2   1.9   28   89-118   246-273 (273)
146 TIGR00375 conserved hypothetic  22.8      25 0.00053   30.6  -0.4   32   84-119   236-267 (374)
147 PRK14892 putative transcriptio  22.8      79  0.0017   22.4   2.3   33   87-120    20-52  (99)
148 COG1645 Uncharacterized Zn-fin  22.7      66  0.0014   24.1   1.9   25   89-119    29-53  (131)
149 PF12172 DUF35_N:  Rubredoxin-l  22.4      56  0.0012   18.4   1.2   25   87-119    10-34  (37)
150 KOG4623 Uncharacterized conser  22.3      31 0.00067   31.5   0.2   34   87-124    27-61  (611)
151 cd02344 ZZ_HERC2 Zinc finger,   22.2      63  0.0014   19.7   1.5   22   89-117     1-22  (45)
152 COG3677 Transposase and inacti  21.8      41 0.00088   24.8   0.7   36   88-123    30-66  (129)
153 PF03966 Trm112p:  Trm112p-like  21.8      20 0.00043   23.1  -0.9   17  106-122    49-65  (68)
154 PF06677 Auto_anti-p27:  Sjogre  21.6      79  0.0017   18.9   1.8   24   89-117    18-41  (41)
155 COG2093 DNA-directed RNA polym  21.4      36 0.00078   22.5   0.3   23   89-119     5-27  (64)
156 COG2260 Predicted Zn-ribbon RN  21.4      62  0.0013   21.1   1.4   26   88-123     5-30  (59)
157 PF04981 NMD3:  NMD3 family ;    21.2      74  0.0016   25.4   2.1   20   86-106    33-52  (236)
158 PF06524 NOA36:  NOA36 protein;  21.2      54  0.0012   27.7   1.3   16  103-118   135-150 (314)
159 COG0846 SIR2 NAD-dependent pro  21.2      54  0.0012   26.9   1.4   18   87-104   145-163 (250)
160 PRK12366 replication factor A;  20.9      72  0.0016   29.5   2.2   29   86-120   530-558 (637)
161 PRK05452 anaerobic nitric oxid  20.8      44 0.00096   29.6   0.8   35   85-119   422-467 (479)
162 smart00704 ZnF_CDGSH CDGSH-typ  20.4 1.2E+02  0.0025   17.7   2.3   18  105-123     9-26  (38)
163 PF04959 ARS2:  Arsenite-resist  20.3      46   0.001   26.8   0.8   25   96-121    64-88  (214)
164 COG1545 Predicted nucleic-acid  20.0      80  0.0017   23.4   2.0   25   88-120    29-53  (140)

No 1  
>KOG1984 consensus Vesicle coat complex COPII, subunit SFB3 [Intracellular trafficking, secretion, and vesicular transport]
Probab=100.00  E-value=4.3e-35  Score=265.21  Aligned_cols=107  Identities=52%  Similarity=1.115  Sum_probs=104.0

Q ss_pred             CCCCCCCceeEecccCCCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCCCCcE
Q 032449           18 KPPPPVTSKYIVKDTGNCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCCCRGY   97 (140)
Q Consensus        18 ~~pp~~~~~~~~~d~gn~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~C~aY   97 (140)
                      ..||++||+|++.|||||+|+|||+|+|.||.|.++++.++||||+||+||+.+.+.|+++|+||+++.+++||+||+||
T Consensus       268 ~~PPl~TTd~~~~DqGN~sPr~mr~T~Y~iP~T~Dl~~as~iPLalvIqPfa~l~p~E~~~~vVd~g~sgPvRC~RCkaY  347 (1007)
T KOG1984|consen  268 QPPPLVTTDFFIQDQGNCSPRFMRCTMYTIPCTNDLLKASQIPLALVIQPFATLTPNEAPVPVVDLGESGPVRCNRCKAY  347 (1007)
T ss_pred             CCCCCcccceEEeccCCCCcchheeecccCCccHhHHHhcCCcceeEecccccCCcccCCCceecCCCCCCcchhhhhhh
Confidence            36999999999999999999999999999999999999999999999999999988888999999999999999999999


Q ss_pred             EcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           98 RNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        98 iNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      ||||++|+++||+|+||||+.+|.+|.
T Consensus       348 inPFmqF~~~gr~f~Cn~C~~~n~vp~  374 (1007)
T KOG1984|consen  348 INPFMQFIDGGRKFICNFCGSKNQVPD  374 (1007)
T ss_pred             cCcceEEecCCceEEecCCCccccCCh
Confidence            999999999999999999999999984


No 2  
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion]
Probab=99.96  E-value=1.6e-30  Score=233.58  Aligned_cols=104  Identities=37%  Similarity=0.773  Sum_probs=96.3

Q ss_pred             CCCCCCceeEecccCCCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCCCCcEE
Q 032449           19 PPPPVTSKYIVKDTGNCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCCCRGYR   98 (140)
Q Consensus        19 ~pp~~~~~~~~~d~gn~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~C~aYi   98 (140)
                      .||. ++.++..+++||+|+|||+|+|+||.+.+++++++||||+||+||.++.++|.++|++..  ..|+||++||+||
T Consensus       133 ~ppl-tt~~~~~e~~n~~p~yvrsT~yaiP~t~dl~~~skiPfgLVI~Pf~~l~~e~~~vpl~~d--~~ivRCrrCrsYi  209 (861)
T COG5028         133 VPPL-TTNFVGSEQSNCSPKYVRSTMYAIPETNDLLKKSKIPFGLVIRPFLELYPEEDPVPLVED--GSIVRCRRCRSYI  209 (861)
T ss_pred             CCCc-ccceeeeccCCCCHHHHHHHHhhCCCchhHHHhcCCCceEEeehhhhcCccCCCCccCCC--CcchhhhhhHhhc
Confidence            4665 999999999999999999999999999999999999999999999998887777888763  3489999999999


Q ss_pred             cCceeEEeCCcEEEEccCCCCCCCCCC
Q 032449           99 NPFMEFVDNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        99 NPf~~~~~~g~~w~C~lC~~~N~lp~~  125 (140)
                      |||.+|+++|++|+||+|+.+|.+|.-
T Consensus       210 NPfv~fi~~g~kw~CNiC~~kN~vp~~  236 (861)
T COG5028         210 NPFVQFIEQGRKWRCNICRSKNDVPEG  236 (861)
T ss_pred             CceEEEecCCcEEEEeeccccccCccc
Confidence            999999999999999999999999963


No 3  
>KOG1985 consensus Vesicle coat complex COPII, subunit SEC24/subunit SFB2 [Intracellular trafficking, secretion, and vesicular transport]
Probab=99.93  E-value=4.1e-27  Score=212.78  Aligned_cols=91  Identities=44%  Similarity=0.868  Sum_probs=83.0

Q ss_pred             ccCCCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCCCCcEEcCceeEEeCCcE
Q 032449           31 DTGNCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCCCRGYRNPFMEFVDNGKS  110 (140)
Q Consensus        31 d~gn~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~C~aYiNPf~~~~~~g~~  110 (140)
                      ..-||+|+|||+|+++||++.++++|+|||||++|+||++.+ ++.++|++.  ...|+||++||+|||||+.|++.|++
T Consensus       164 ~~~nc~p~y~RsTl~~iP~t~sLl~kskLPlglvv~Pf~~~~-d~~~~p~~~--~~~IvRCr~CRtYiNPFV~fid~gr~  240 (887)
T KOG1985|consen  164 ESSNCSPSYVRSTLSAIPQTQSLLKKSKLPLGLVVHPFAHLD-DIDPLPVIT--STLIVRCRRCRTYINPFVEFIDQGRR  240 (887)
T ss_pred             cccCCCHHHHHHHHHhCCccHHHHHhcCCCceEEEeeccccc-ccCCCCccc--CCceeeehhhhhhcCCeEEecCCCce
Confidence            457999999999999999999999999999999999999876 334566664  57899999999999999999999999


Q ss_pred             EEEccCCCCCCCCC
Q 032449          111 FVCNFCGVWMLMRG  124 (140)
Q Consensus       111 w~C~lC~~~N~lp~  124 (140)
                      |+||+|+..|.+|.
T Consensus       241 WrCNlC~~~NdvP~  254 (887)
T KOG1985|consen  241 WRCNLCGRVNDVPD  254 (887)
T ss_pred             eeechhhhhcCCcH
Confidence            99999999999995


No 4  
>PLN00162 transport protein sec23; Provisional
Probab=99.93  E-value=4.7e-26  Score=207.85  Aligned_cols=86  Identities=23%  Similarity=0.309  Sum_probs=79.1

Q ss_pred             CCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCCCCcEEcCceeEEeCCcEEEEc
Q 032449           35 CSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCCCRGYRNPFMEFVDNGKSFVCN  114 (140)
Q Consensus        35 ~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~  114 (140)
                      .+.++||+|||+||.+++++++++||||++|+||++..    ++|+++   .+|+||++|+|||||||+|++++++|+||
T Consensus         7 e~~~gvR~s~n~~P~t~~~~~~~~iPlg~v~tPl~~~~----~vp~v~---~~pvRC~~CraylNPf~~~d~~~~~W~C~   79 (761)
T PLN00162          7 EAIDGVRMSWNVWPSSKIEASKCVIPLAALYTPLKPLP----ELPVLP---YDPLRCRTCRAVLNPYCRVDFQAKIWICP   79 (761)
T ss_pred             cccCceEeeeecCCCCHHHHhcCCCCeEEEEecCCcCC----CCCcCC---CCCCccCCCcCEECCceEEecCCCEEEcc
Confidence            46689999999999999999999999999999998763    488887   57999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCc
Q 032449          115 FCGVWMLMRGLSS  127 (140)
Q Consensus       115 lC~~~N~lp~~~~  127 (140)
                      ||+..|.+|..+.
T Consensus        80 ~C~~~N~~P~~Y~   92 (761)
T PLN00162         80 FCFQRNHFPPHYS   92 (761)
T ss_pred             CCCCCCCCchHhc
Confidence            9999999997654


No 5  
>PTZ00395 Sec24-related protein; Provisional
Probab=99.90  E-value=6e-25  Score=206.35  Aligned_cols=125  Identities=30%  Similarity=0.457  Sum_probs=110.4

Q ss_pred             CceEEeccCCCCCCCCCCCCceeEecccCCCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccC
Q 032449            5 SVILYETRQGKSVKPPPPVTSKYIVKDTGNCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFG   84 (140)
Q Consensus         5 ~~~~~~t~~~~~~~~pp~~~~~~~~~d~gn~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~   84 (140)
                      ...+|+|++..   .||+.+++|+++|+|||+|+|||+|||.||.+.++++.+.|||||||+||+...++| .||.++..
T Consensus       623 ~~~~~~t~k~~---~pp~~~~~~~~~dtgn~dP~~~r~tmY~iP~~~~~~~~~~iP~gi~v~Pfa~~~~~e-~~~~~~~~  698 (1560)
T PTZ00395        623 NLKVFETCKYI---SPPSYYQPYISIDTGKADPRFLKSTLYQIPLFSETLKLSQIPFGIIVNPFACLNEGE-GIDKIDMK  698 (1560)
T ss_pred             cchhhhhccCC---CCCCCCCceEEeecCCCChhhhhhhhhcCcchHHHHHhcCCCceeecchhhhcCCCC-CCcccchh
Confidence            34789999887   589999999999999999999999999999999999999999999999999988776 58888765


Q ss_pred             --------CCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC-CCCcccccccc
Q 032449           85 --------ESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR-GLSSVEGQLNL  134 (140)
Q Consensus        85 --------~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp-~~~~~~~~~~~  134 (140)
                              ...|+||.+|++|+|+++.++.. +++.|+||+..+.+. +...+.-||+.
T Consensus       699 ~~~~d~~~~~~~~rc~~c~~y~~~~~~~~~~-~~~~c~~c~~~~~i~e~~~~~~~~~~~  756 (1560)
T PTZ00395        699 DIINDKEENIEILRCPKCLGYLHATILEDIS-SSVQCVFCDTDFLINENVLFDIFQYNE  756 (1560)
T ss_pred             hcccchhhccceeecchhHhhhcchheeccc-ceEEEEecCCcchhhHHHHHHHHHHhh
Confidence                    24789999999999999999875 899999999999984 46666666654


No 6  
>KOG1986 consensus Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking, secretion, and vesicular transport]
Probab=99.79  E-value=2.7e-20  Score=166.59  Aligned_cols=97  Identities=22%  Similarity=0.261  Sum_probs=87.0

Q ss_pred             CCCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCCCCcEEcCceeEEeCCcEEE
Q 032449           33 GNCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCCCRGYRNPFMEFVDNGKSFV  112 (140)
Q Consensus        33 gn~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~C~aYiNPf~~~~~~g~~w~  112 (140)
                      .+.+.+.||+|||+||.++....++.+|++++++||.+..    .+|.+.   ++|+||++|+||+||||.+|.+.+.|+
T Consensus         5 ~~e~~dGvR~twnvwPs~~~~~~~~vvPla~lytPl~e~~----~~~~~~---y~P~~C~~C~AvlNPyc~vd~~a~~W~   77 (745)
T KOG1986|consen    5 DIEEIDGVRFTWNVWPSTRAEASRTVVPLACLYTPLKERP----DLPPIQ---YDPLRCSKCGAVLNPYCSVDFRAKSWI   77 (745)
T ss_pred             ccccCCCcccccccCCCcccccccccccHHHhccccccCC----CCCccC---CCCchhccchhhcCcceeecccCceEe
Confidence            3567899999999999999999999999999999998653    256664   789999999999999999999999999


Q ss_pred             EccCCCCCCCCCCCcccccccccc
Q 032449          113 CNFCGVWMLMRGLSSVEGQLNLLL  136 (140)
Q Consensus       113 C~lC~~~N~lp~~~~~~~~~~~~~  136 (140)
                      |+||.+.|.+|..|......++|.
T Consensus        78 CpfC~qrN~~p~~Y~~is~~n~P~  101 (745)
T KOG1986|consen   78 CPFCNQRNPFPPHYSGISENNLPP  101 (745)
T ss_pred             ccccccCCCCChhhcccCccCCCh
Confidence            999999999999888888877764


No 7  
>COG5047 SEC23 Vesicle coat complex COPII, subunit SEC23 [Intracellular trafficking and secretion]
Probab=99.73  E-value=1.1e-18  Score=154.21  Aligned_cols=97  Identities=23%  Similarity=0.335  Sum_probs=87.8

Q ss_pred             CCCCCeeEeeccccCCCHHHHhhcCCCeEEEEeeccCCCCCCCCCceeccCCCCeeecCC-CCcEEcCceeEEeCCcEEE
Q 032449           34 NCSPRYIRCSLNQIPCTENLLKLSSMPSALMVQVLALPDPSEDPIPVVDFGESGLVRCCC-CRGYRNPFMEFVDNGKSFV  112 (140)
Q Consensus        34 n~~p~~vR~T~~~iP~t~~l~~~~~iPlgivv~Pf~~~~~~e~~vp~v~~~~~~~~RC~~-C~aYiNPf~~~~~~g~~w~  112 (140)
                      +.+.++||+|||+||.++....++.+|++++++||.+.+    .+++.   .+.|+.|.. |+||+||||.++.+.+.|+
T Consensus         6 iee~dgir~twnvfpat~~da~~~~iPia~lY~Pl~e~~----~~~v~---~yepv~C~~pC~avlnpyC~id~r~~~W~   78 (755)
T COG5047           6 IEENDGIRLTWNVFPATRGDATRTVIPIACLYTPLHEDD----ALTVN---YYEPVKCTAPCKAVLNPYCHIDERNQSWI   78 (755)
T ss_pred             hccccceEEEEecccCCccccccccccHHHhcccccccc----ccCcc---cCCCceecccchhhcCcceeeccCCceEe
Confidence            467889999999999999999999999999999998653    24444   378999999 9999999999999999999


Q ss_pred             EccCCCCCCCCCCCccccccccccC
Q 032449          113 CNFCGVWMLMRGLSSVEGQLNLLLQ  137 (140)
Q Consensus       113 C~lC~~~N~lp~~~~~~~~~~~~~~  137 (140)
                      |+||+..|.||..+.+.++.+|||.
T Consensus        79 CpfCnqrn~lp~qy~~iS~~~Lple  103 (755)
T COG5047          79 CPFCNQRNTLPPQYRDISNANLPLE  103 (755)
T ss_pred             cceecCCCCCChhhcCCCcccCCcc
Confidence            9999999999999999999999874


No 8  
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=99.73  E-value=5.4e-19  Score=106.77  Aligned_cols=39  Identities=49%  Similarity=1.016  Sum_probs=27.7

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~~  125 (140)
                      +|+||++|+||||||++|++++++|+|+||++.|.||..
T Consensus         1 ~p~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~N~lp~~   39 (40)
T PF04810_consen    1 GPVRCRRCRAYLNPFCQFDDGGKTWICNFCGTKNPLPPH   39 (40)
T ss_dssp             -S-B-TTT--BS-TTSEEETTTTEEEETTT--EEE--GG
T ss_pred             CccccCCCCCEECCcceEcCCCCEEECcCCCCcCCCCCC
Confidence            489999999999999999999999999999999999864


No 9  
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=90.31  E-value=0.11  Score=34.04  Aligned_cols=32  Identities=34%  Similarity=0.827  Sum_probs=22.8

Q ss_pred             CceeccCCCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           78 IPVVDFGESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        78 vp~v~~~~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .|--+.|+..|.||++||-.          |..|+|+-||..
T Consensus        28 F~CPnCGe~~I~Rc~~CRk~----------g~~Y~Cp~CGF~   59 (61)
T COG2888          28 FPCPNCGEVEIYRCAKCRKL----------GNPYRCPKCGFE   59 (61)
T ss_pred             eeCCCCCceeeehhhhHHHc----------CCceECCCcCcc
Confidence            33446677789999999853          456778888764


No 10 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=89.19  E-value=0.35  Score=27.49  Aligned_cols=29  Identities=28%  Similarity=0.445  Sum_probs=22.5

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWML  121 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~  121 (140)
                      +.|..|++-|--    -.+..+++|.+|...|.
T Consensus         2 ~~C~~C~t~L~y----P~gA~~vrCs~C~~vt~   30 (31)
T TIGR01053         2 VVCGGCRTLLMY----PRGASSVRCALCQTVNL   30 (31)
T ss_pred             cCcCCCCcEeec----CCCCCeEECCCCCeEec
Confidence            578899988752    25678999999998774


No 11 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=88.48  E-value=0.31  Score=28.43  Aligned_cols=33  Identities=21%  Similarity=0.516  Sum_probs=24.0

Q ss_pred             eeecCCCCcEEc-CceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRN-PFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiN-Pf~~~~~~g~~w~C~lC~~~N  120 (140)
                      +++|.+|++-.+ |--++...|++.+|.-|++.-
T Consensus         2 ~i~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    2 IITCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             EEECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            478888887766 555566677888888888753


No 12 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=88.22  E-value=0.37  Score=30.68  Aligned_cols=34  Identities=15%  Similarity=0.260  Sum_probs=24.7

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -.+-|++|++-=.-+-+-+...-+|+|..|+..|
T Consensus        21 ~aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~~N   54 (54)
T PF10058_consen   21 YALICSKCFSHNGLAPKEEFEEIQYRCPYCGALN   54 (54)
T ss_pred             eeEECcccchhhcccccccCCceEEEcCCCCCcC
Confidence            3567999987644332555555699999999987


No 13 
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=87.83  E-value=0.37  Score=32.26  Aligned_cols=30  Identities=27%  Similarity=0.635  Sum_probs=20.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      |.|| +|+.|+    ..+++.++-+| .||....+.
T Consensus         3 ifrC-~Cgr~l----ya~e~~kTkkC-~CG~~l~vk   32 (68)
T PF09082_consen    3 IFRC-DCGRYL----YAKEGAKTKKC-VCGKTLKVK   32 (68)
T ss_dssp             EEEE-TTS--E----EEETT-SEEEE-TTTEEEE--
T ss_pred             EEEe-cCCCEE----EecCCcceeEe-cCCCeeeee
Confidence            7899 799986    35677789999 999888775


No 14 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=85.69  E-value=0.63  Score=28.11  Aligned_cols=31  Identities=23%  Similarity=0.636  Sum_probs=21.7

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      ..+|.+|++-+-    ++.....++|+.||....+
T Consensus         3 ~y~C~~CG~~~~----~~~~~~~~~Cp~CG~~~~~   33 (46)
T PRK00398          3 EYKCARCGREVE----LDEYGTGVRCPYCGYRILF   33 (46)
T ss_pred             EEECCCCCCEEE----ECCCCCceECCCCCCeEEE
Confidence            468999999553    3333347999999976543


No 15 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=83.86  E-value=0.5  Score=30.82  Aligned_cols=28  Identities=32%  Similarity=0.701  Sum_probs=19.4

Q ss_pred             ccCCCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           82 DFGESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        82 ~~~~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      +.|+..|.||.+||-.-          ..|+|+-||..
T Consensus        30 nCG~~~I~RC~~CRk~~----------~~Y~CP~CGF~   57 (59)
T PRK14890         30 NCGEVIIYRCEKCRKQS----------NPYTCPKCGFE   57 (59)
T ss_pred             CCCCeeEeechhHHhcC----------CceECCCCCCc
Confidence            34555588999998544          45678888764


No 16 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=83.11  E-value=0.74  Score=27.96  Aligned_cols=32  Identities=25%  Similarity=0.399  Sum_probs=21.7

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      -|.+|+..|-+-  -..++..|.|+-|+....+.
T Consensus         2 FCp~Cg~~l~~~--~~~~~~~~vC~~Cg~~~~~~   33 (52)
T smart00661        2 FCPKCGNMLIPK--EGKEKRRFVCRKCGYEEPIE   33 (52)
T ss_pred             CCCCCCCccccc--cCCCCCEEECCcCCCeEECC
Confidence            488898877332  22223589999999877664


No 17 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=80.16  E-value=1.3  Score=32.01  Aligned_cols=32  Identities=13%  Similarity=0.236  Sum_probs=26.1

Q ss_pred             eeecCCCCcEEcCceeEEe-CCcEEEEccCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVD-NGKSFVCNFCGVW  119 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~-~g~~w~C~lC~~~  119 (140)
                      -..|..|+-.|..-|.+.. +...|.|.+|...
T Consensus        71 ~~~C~~C~~~VC~~C~~~~~~~~~WlC~vC~k~  103 (118)
T PF02318_consen   71 GRVCVDCKHRVCKKCGVYSKKEPIWLCKVCQKQ  103 (118)
T ss_dssp             CEEETTTTEEEETTSEEETSSSCCEEEHHHHHH
T ss_pred             CCcCCcCCccccCccCCcCCCCCCEEChhhHHH
Confidence            3889999999998888874 5679999999643


No 18 
>PRK03954 ribonuclease P protein component 4; Validated
Probab=79.06  E-value=1.4  Score=32.61  Aligned_cols=37  Identities=22%  Similarity=0.354  Sum_probs=25.8

Q ss_pred             eecCCCCcEEcCc----eeEEeCC---cEEEEccCCCCCCCCCC
Q 032449           89 VRCCCCRGYRNPF----MEFVDNG---KSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        89 ~RC~~C~aYiNPf----~~~~~~g---~~w~C~lC~~~N~lp~~  125 (140)
                      --|++|.+||=|-    +.+..+.   -.++|..||+..-+|-.
T Consensus        65 ~~CK~C~t~LiPG~n~~vRi~~~~~~~vvitCl~CG~~kR~P~~  108 (121)
T PRK03954         65 RYCKRCHSFLVPGVNARVRLRQKRMPHVVITCLECGHIMRYPYL  108 (121)
T ss_pred             HHhhcCCCeeecCCceEEEEecCCcceEEEECccCCCEEeeccc
Confidence            4599999999773    3343321   23599999999887743


No 19 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=78.02  E-value=1.4  Score=25.57  Aligned_cols=32  Identities=19%  Similarity=0.482  Sum_probs=20.2

Q ss_pred             eeecCCCCcEEc-CceeEEeCCcEEEEccCCCC
Q 032449           88 LVRCCCCRGYRN-PFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        88 ~~RC~~C~aYiN-Pf~~~~~~g~~w~C~lC~~~  119 (140)
                      .++|.+|++-.+ +=-++-..|++.+|.-|++.
T Consensus         2 ~i~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~   34 (36)
T PF13717_consen    2 IITCPNCQAKYEIDDEKIPPKGRKVRCSKCGHV   34 (36)
T ss_pred             EEECCCCCCEEeCCHHHCCCCCcEEECCCCCCE
Confidence            467777776554 33334456677777777764


No 20 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=75.81  E-value=1.3  Score=26.36  Aligned_cols=30  Identities=20%  Similarity=0.389  Sum_probs=25.4

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      -||.+|+....=+..+.+ .....|+-|+..
T Consensus         6 y~C~~Cg~~fe~~~~~~~-~~~~~CP~Cg~~   35 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSISE-DDPVPCPECGST   35 (42)
T ss_pred             EEeCCCCCEEEEEEEcCC-CCCCcCCCCCCC
Confidence            689999988888887777 678999999973


No 21 
>COG5415 Predicted integral membrane metal-binding protein [General function prediction only]
Probab=73.97  E-value=2  Score=34.97  Aligned_cols=51  Identities=16%  Similarity=0.068  Sum_probs=35.9

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC---CCCccccccccccCc
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR---GLSSVEGQLNLLLQG  138 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp---~~~~~~~~~~~~~~~  138 (140)
                      -+-|++|.-==+-+---...-..|+|.+|++.|..+   ..+++..|++-+-||
T Consensus       192 alIC~~C~hhngl~~~~ek~~~efiC~~Cn~~n~~~~~~~dsn~~~~p~~~s~~  245 (251)
T COG5415         192 ALICPQCHHHNGLYRLAEKPIIEFICPHCNHKNDEVKEREDSNEAKQPAQPSQS  245 (251)
T ss_pred             hhccccccccccccccccccchheecccchhhcCcccccccchhhcCCCCcccc
Confidence            366777765444333333444579999999999876   477788888887776


No 22 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=73.71  E-value=3.9  Score=24.20  Aligned_cols=27  Identities=26%  Similarity=0.639  Sum_probs=19.8

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      +|..|++--   ..+|.....++|.-||..
T Consensus         2 ~Cp~Cg~~~---~~~D~~~g~~vC~~CG~V   28 (43)
T PF08271_consen    2 KCPNCGSKE---IVFDPERGELVCPNCGLV   28 (43)
T ss_dssp             SBTTTSSSE---EEEETTTTEEEETTT-BB
T ss_pred             CCcCCcCCc---eEEcCCCCeEECCCCCCE
Confidence            688888833   467777788999999854


No 23 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=73.34  E-value=2.3  Score=30.63  Aligned_cols=28  Identities=14%  Similarity=0.214  Sum_probs=19.9

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...||..|+....      .....|.|+-||..+
T Consensus        69 ~~~~C~~Cg~~~~------~~~~~~~CP~Cgs~~   96 (113)
T PRK12380         69 AQAWCWDCSQVVE------IHQHDAQCPHCHGER   96 (113)
T ss_pred             cEEEcccCCCEEe------cCCcCccCcCCCCCC
Confidence            4689999995433      323567899999654


No 24 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=73.33  E-value=2.2  Score=24.09  Aligned_cols=24  Identities=25%  Similarity=0.501  Sum_probs=15.6

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      +|..|+=...+-.      .-|.|++|+..
T Consensus         3 ~C~~CGy~y~~~~------~~~~CP~Cg~~   26 (33)
T cd00350           3 VCPVCGYIYDGEE------APWVCPVCGAP   26 (33)
T ss_pred             ECCCCCCEECCCc------CCCcCcCCCCc
Confidence            6777774333322      57999999873


No 25 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=72.23  E-value=1.9  Score=26.27  Aligned_cols=31  Identities=23%  Similarity=0.396  Sum_probs=22.7

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -||.+|+....-+..+.+ .....|+.|+..+
T Consensus         6 y~C~~Cg~~fe~~~~~~~-~~~~~CP~Cg~~~   36 (52)
T TIGR02605         6 YRCTACGHRFEVLQKMSD-DPLATCPECGGEK   36 (52)
T ss_pred             EEeCCCCCEeEEEEecCC-CCCCCCCCCCCCc
Confidence            589999986666555544 3567899999854


No 26 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=72.12  E-value=2.6  Score=30.39  Aligned_cols=28  Identities=21%  Similarity=0.282  Sum_probs=20.5

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...||.+|+.+..+-      ...|.|+-|+..+
T Consensus        69 ~~~~C~~Cg~~~~~~------~~~~~CP~Cgs~~   96 (115)
T TIGR00100        69 VECECEDCSEEVSPE------IDLYRCPKCHGIM   96 (115)
T ss_pred             cEEEcccCCCEEecC------CcCccCcCCcCCC
Confidence            458999999655432      2368999999765


No 27 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=71.85  E-value=3  Score=24.30  Aligned_cols=27  Identities=22%  Similarity=0.460  Sum_probs=20.7

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      ..+|..|++.   +...++  .+|.|.-||+.
T Consensus         8 ~~~C~~C~~~---~~~~~d--G~~yC~~cG~~   34 (36)
T PF11781_consen    8 NEPCPVCGSR---WFYSDD--GFYYCDRCGHQ   34 (36)
T ss_pred             CCcCCCCCCe---EeEccC--CEEEhhhCceE
Confidence            3679999999   554544  38999999975


No 28 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=71.67  E-value=1.5  Score=27.79  Aligned_cols=36  Identities=22%  Similarity=0.411  Sum_probs=25.1

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRGLS  126 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~~~  126 (140)
                      +||.+|+-.|----.+..  -.-+|+=|++.|.+....
T Consensus         5 iRC~~CnklLa~~g~~~~--leIKCpRC~tiN~~~a~~   40 (51)
T PF10122_consen    5 IRCGHCNKLLAKAGEVIE--LEIKCPRCKTINHVRATS   40 (51)
T ss_pred             eeccchhHHHhhhcCccE--EEEECCCCCccceEeccC
Confidence            899999876654211221  258999999999987644


No 29 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=70.92  E-value=1.6  Score=27.29  Aligned_cols=30  Identities=30%  Similarity=0.635  Sum_probs=19.4

Q ss_pred             ecCCCCcEEcCc-----------eeEEeCCcEEEEccCCCC
Q 032449           90 RCCCCRGYRNPF-----------MEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        90 RC~~C~aYiNPf-----------~~~~~~g~~w~C~lC~~~  119 (140)
                      +|..|+-..+|-           +.|++--..|+|++|+..
T Consensus         3 ~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a~   43 (50)
T cd00730           3 ECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGAG   43 (50)
T ss_pred             CCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCCc
Confidence            677777555543           334444457999999853


No 30 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=69.22  E-value=7.1  Score=22.29  Aligned_cols=30  Identities=30%  Similarity=0.609  Sum_probs=21.1

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      .+.+|..|++-+    -+........|.+|+...
T Consensus         2 ~~~~C~~C~~~~----i~~~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    2 NLKKCSKCGGNG----IVNKEDDYEVCIFCGSSF   31 (33)
T ss_pred             CceEcCCCCCCe----EEEecCCeEEcccCCcEe
Confidence            367899999866    221333589999999764


No 31 
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=69.20  E-value=3.1  Score=30.73  Aligned_cols=34  Identities=15%  Similarity=0.457  Sum_probs=23.0

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      ++|.-|+..-  -..++...+.|.|.-|+..|.+..
T Consensus         1 v~C~fC~~~s--~~~~~~~~~~w~C~~C~q~N~f~e   34 (131)
T PF09779_consen    1 VNCWFCGQNS--KVPYDNRNSNWTCPHCEQYNGFDE   34 (131)
T ss_pred             CeeccCCCCC--CCCCCCCCCeeECCCCCCccCccc
Confidence            3677776653  233344455699999999997754


No 32 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=68.66  E-value=3.5  Score=29.71  Aligned_cols=29  Identities=21%  Similarity=0.369  Sum_probs=19.4

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...||.+|+.+...-     ....|.|+-||..+
T Consensus        69 ~~~~C~~Cg~~~~~~-----~~~~~~CP~Cgs~~   97 (114)
T PRK03681         69 AECWCETCQQYVTLL-----TQRVRRCPQCHGDM   97 (114)
T ss_pred             cEEEcccCCCeeecC-----CccCCcCcCcCCCC
Confidence            458999999643221     11248899999664


No 33 
>PRK12722 transcriptional activator FlhC; Provisional
Probab=68.64  E-value=2.2  Score=33.71  Aligned_cols=31  Identities=35%  Similarity=0.740  Sum_probs=22.0

Q ss_pred             CCCeeecCCCCc-EEcCceeEEeCCcEEEEccCCC
Q 032449           85 ESGLVRCCCCRG-YRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        85 ~~~~~RC~~C~a-YiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      ...+.+|++|++ ||-..   .+....++|++|.-
T Consensus       131 ~L~l~~C~~Cgg~fv~~~---~e~~~~f~CplC~~  162 (187)
T PRK12722        131 MLQLSSCNCCGGHFVTHA---HDPVGSFVCGLCQP  162 (187)
T ss_pred             cEeeccCCCCCCCeeccc---cccCCCCcCCCCCC
Confidence            355789999986 55222   24457899999985


No 34 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=68.50  E-value=2.5  Score=24.26  Aligned_cols=29  Identities=24%  Similarity=0.409  Sum_probs=21.6

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      .||..|+..+.-...+.+ +....|+-|+.
T Consensus         6 y~C~~Cg~~fe~~~~~~~-~~~~~CP~Cg~   34 (41)
T smart00834        6 YRCEDCGHTFEVLQKISD-DPLATCPECGG   34 (41)
T ss_pred             EEcCCCCCEEEEEEecCC-CCCCCCCCCCC
Confidence            589999987766655544 56788999987


No 35 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=66.05  E-value=3.7  Score=32.53  Aligned_cols=27  Identities=30%  Similarity=0.591  Sum_probs=21.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -.||++|++-|=.      .++..+|+-|+..-
T Consensus       149 ~A~CsrC~~~L~~------~~~~l~Cp~Cg~tE  175 (188)
T COG1096         149 YARCSRCRAPLVK------KGNMLKCPNCGNTE  175 (188)
T ss_pred             EEEccCCCcceEE------cCcEEECCCCCCEE
Confidence            4799999998743      56899999999753


No 36 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=64.09  E-value=2.2  Score=24.64  Aligned_cols=29  Identities=28%  Similarity=0.534  Sum_probs=13.7

Q ss_pred             cCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           91 CCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        91 C~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      |..|++=+.--.--.++..+++|.-|+..
T Consensus         3 C~~CG~~l~~~ip~gd~r~R~vC~~Cg~I   31 (34)
T PF14803_consen    3 CPQCGGPLERRIPEGDDRERLVCPACGFI   31 (34)
T ss_dssp             -TTT--B-EEE--TT-SS-EEEETTTTEE
T ss_pred             cccccChhhhhcCCCCCccceECCCCCCE
Confidence            66777665433222256678888888754


No 37 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=62.85  E-value=4.2  Score=25.52  Aligned_cols=31  Identities=23%  Similarity=0.626  Sum_probs=21.7

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      .=+|.+|++-+    ..+.......|+-||+.-.+
T Consensus         6 ~Y~C~~Cg~~~----~~~~~~~~irCp~Cg~rIl~   36 (49)
T COG1996           6 EYKCARCGREV----ELDQETRGIRCPYCGSRILV   36 (49)
T ss_pred             EEEhhhcCCee----ehhhccCceeCCCCCcEEEE
Confidence            45788888877    44555677888888876433


No 38 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=62.82  E-value=5.3  Score=25.57  Aligned_cols=29  Identities=28%  Similarity=0.573  Sum_probs=22.3

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      --.|..|+...--    ...++.|.|.-||..-
T Consensus        28 Sq~C~~CG~~~~~----~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   28 SQTCPRCGHRNKK----RRSGRVFTCPNCGFEM   56 (69)
T ss_pred             ccCccCccccccc----ccccceEEcCCCCCEE
Confidence            3568888877665    4567899999999863


No 39 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=61.53  E-value=7.3  Score=20.91  Aligned_cols=24  Identities=29%  Similarity=0.667  Sum_probs=16.2

Q ss_pred             cCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           91 CCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        91 C~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      |.+|+.-|-|--    .+..|.|+-||.
T Consensus         1 C~sC~~~i~~r~----~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPRE----QAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCcc----cCceEeCCCCCC
Confidence            667777777653    245788888873


No 40 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=60.96  E-value=3.7  Score=21.54  Aligned_cols=21  Identities=29%  Similarity=0.627  Sum_probs=12.4

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      +|.+|++-|..-.+|        |+-||+
T Consensus         1 ~Cp~CG~~~~~~~~f--------C~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKF--------CPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcc--------hhhhCC
Confidence            467777766543333        666665


No 41 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=60.77  E-value=7.7  Score=21.15  Aligned_cols=29  Identities=28%  Similarity=0.544  Sum_probs=16.4

Q ss_pred             ecCCCCcEEcCc-eeEEeCCcE-----EEEccCCC
Q 032449           90 RCCCCRGYRNPF-MEFVDNGKS-----FVCNFCGV  118 (140)
Q Consensus        90 RC~~C~aYiNPf-~~~~~~g~~-----w~C~lC~~  118 (140)
                      ||.+|+-.|-+- ..+...++.     |.|..|+.
T Consensus         1 ~C~~C~~~i~~~~~~~~~~~~~~H~~Cf~C~~C~~   35 (39)
T smart00132        1 KCAGCGKPIRGGELVLRALGKVWHPECFKCSKCGK   35 (39)
T ss_pred             CccccCCcccCCcEEEEeCCccccccCCCCcccCC
Confidence            678888877763 223333333     35666654


No 42 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=59.63  E-value=11  Score=22.58  Aligned_cols=27  Identities=15%  Similarity=0.472  Sum_probs=19.2

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      +.|.+|++- ..|  .......|.|.-|++
T Consensus        19 ~~CP~Cg~~-~~~--~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   19 FVCPHCGST-KHY--RLKTRGRYRCKACRK   45 (46)
T ss_pred             CCCCCCCCe-eeE--EeCCCCeEECCCCCC
Confidence            669999987 332  223357999999985


No 43 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=58.99  E-value=3.1  Score=22.72  Aligned_cols=13  Identities=15%  Similarity=0.373  Sum_probs=11.3

Q ss_pred             EEEEccCCCCCCC
Q 032449          110 SFVCNFCGVWMLM  122 (140)
Q Consensus       110 ~w~C~lC~~~N~l  122 (140)
                      .|.|..|...|..
T Consensus         4 ~W~C~~C~~~N~~   16 (30)
T PF00641_consen    4 DWKCPSCTFMNPA   16 (30)
T ss_dssp             SEEETTTTEEEES
T ss_pred             CccCCCCcCCchH
Confidence            7999999999854


No 44 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=58.86  E-value=4.2  Score=29.43  Aligned_cols=29  Identities=21%  Similarity=0.198  Sum_probs=18.8

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...||.+|+.+..+-    . ...+.|+-|+..+
T Consensus        70 ~~~~C~~Cg~~~~~~----~-~~~~~CP~Cgs~~   98 (117)
T PRK00564         70 VELECKDCSHVFKPN----A-LDYGVCEKCHSKN   98 (117)
T ss_pred             CEEEhhhCCCccccC----C-ccCCcCcCCCCCc
Confidence            469999999543321    1 1234599999765


No 45 
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=58.60  E-value=16  Score=27.22  Aligned_cols=33  Identities=27%  Similarity=0.602  Sum_probs=26.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEE--EEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSF--VCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w--~C~lC~~~N~lp  123 (140)
                      -+-|+.|+.   |=..+...++.|  .|..||..-.+.
T Consensus        97 yVlC~~C~s---PdT~l~k~~r~~~l~C~ACGa~~~v~  131 (133)
T TIGR00311        97 YVICRECNR---PDTRIIKEGRVSLLKCEACGAKAPLR  131 (133)
T ss_pred             eEECCCCCC---CCcEEEEeCCeEEEecccCCCCCccC
Confidence            488999995   888888877776  899999987653


No 46 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=57.54  E-value=8.1  Score=28.72  Aligned_cols=33  Identities=24%  Similarity=0.514  Sum_probs=22.7

Q ss_pred             eeecCCCCcEEcCce-----------eEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFM-----------EFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~-----------~~~~~g~~w~C~lC~~~N  120 (140)
                      ..||..|.+=+-+--           .+......|+|+-|++..
T Consensus        91 ~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   91 FSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            589999999654321           222345699999999754


No 47 
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=57.51  E-value=11  Score=20.46  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=12.3

Q ss_pred             cCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           91 CCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        91 C~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      |.+||+.|-    .-.+...++|..|.+
T Consensus         1 C~~Cr~~L~----yp~GA~sVrCa~C~~   24 (25)
T PF06943_consen    1 CGGCRTLLM----YPRGAPSVRCACCHT   24 (25)
T ss_pred             CCCCCceEE----cCCCCCCeECCccCc
Confidence            445555543    113445666666654


No 48 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=56.10  E-value=7.6  Score=26.93  Aligned_cols=27  Identities=26%  Similarity=0.471  Sum_probs=20.5

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      -|.+|++.|.|-      +..+.|..|+.....
T Consensus         2 fC~~Cg~~l~~~------~~~~~C~~C~~~~~~   28 (104)
T TIGR01384         2 FCPKCGSLMTPK------NGVYVCPSCGYEKEK   28 (104)
T ss_pred             CCcccCcccccC------CCeEECcCCCCcccc
Confidence            488999999652      247999999976544


No 49 
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=55.72  E-value=0.86  Score=28.29  Aligned_cols=32  Identities=22%  Similarity=0.439  Sum_probs=13.0

Q ss_pred             CeeecCCCCcEE----cCceeEEeCCcEEEEccCCC
Q 032449           87 GLVRCCCCRGYR----NPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        87 ~~~RC~~C~aYi----NPf~~~~~~g~~w~C~lC~~  118 (140)
                      .|+|=..|.=.-    .-|.+.......|.|++|++
T Consensus        14 ~P~Rg~~C~H~~CFDl~~fl~~~~~~~~W~CPiC~~   49 (50)
T PF02891_consen   14 IPVRGKNCKHLQCFDLESFLESNQRTPKWKCPICNK   49 (50)
T ss_dssp             SEEEETT--SS--EEHHHHHHHHHHS---B-TTT--
T ss_pred             eCccCCcCcccceECHHHHHHHhhccCCeECcCCcC
Confidence            355555555432    13444445567899999986


No 50 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=55.61  E-value=3.1  Score=25.71  Aligned_cols=30  Identities=30%  Similarity=0.616  Sum_probs=14.7

Q ss_pred             ecCCCCcEEcCc-----------eeEEeCCcEEEEccCCCC
Q 032449           90 RCCCCRGYRNPF-----------MEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        90 RC~~C~aYiNPf-----------~~~~~~g~~w~C~lC~~~  119 (140)
                      +|..|+-.-+|-           ..|++--..|+|+.|+..
T Consensus         3 ~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a~   43 (47)
T PF00301_consen    3 QCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGAP   43 (47)
T ss_dssp             EETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSSB
T ss_pred             CCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCCc
Confidence            566676444432           223333456999999864


No 51 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=54.75  E-value=9.8  Score=21.59  Aligned_cols=31  Identities=23%  Similarity=0.447  Sum_probs=13.9

Q ss_pred             eecCCCCcEEc-CceeEEeCCcEEEEccCCCC
Q 032449           89 VRCCCCRGYRN-PFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        89 ~RC~~C~aYiN-Pf~~~~~~g~~w~C~lC~~~  119 (140)
                      ++|.+|++-.- +=-.+...+.+..|+-|++.
T Consensus         3 ~~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~   34 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQLGANGGKVRCGKCGHV   34 (38)
T ss_pred             EECCCCCCEEEeCHHHcCCCCCEEECCCCCCE
Confidence            45666665321 11112223345666666653


No 52 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=54.58  E-value=7.4  Score=33.78  Aligned_cols=36  Identities=19%  Similarity=0.579  Sum_probs=26.1

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCCCCccc
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRGLSSVE  129 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~~~~~~  129 (140)
                      ...-||.+|+        |.-..-.|-|+-|+..-.+..+-.+.
T Consensus       352 ~~~YRC~~CG--------F~a~~l~W~CPsC~~W~TikPir~~~  387 (389)
T COG2956         352 KPRYRCQNCG--------FTAHTLYWHCPSCRAWETIKPIRGLD  387 (389)
T ss_pred             cCCceecccC--------CcceeeeeeCCCcccccccCCccccc
Confidence            4568999997        33344589999999988776554443


No 53 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=53.47  E-value=6.9  Score=19.03  Aligned_cols=10  Identities=40%  Similarity=1.059  Sum_probs=6.4

Q ss_pred             EEEccCCCCC
Q 032449          111 FVCNFCGVWM  120 (140)
Q Consensus       111 w~C~lC~~~N  120 (140)
                      |+|.+|+...
T Consensus         1 ~~C~~C~~~~   10 (24)
T PF13894_consen    1 FQCPICGKSF   10 (24)
T ss_dssp             EE-SSTS-EE
T ss_pred             CCCcCCCCcC
Confidence            7899998754


No 54 
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=53.46  E-value=8.8  Score=23.26  Aligned_cols=32  Identities=22%  Similarity=0.331  Sum_probs=23.3

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      .+.++|..|+.-|...-.- .....|.|.-...
T Consensus         3 ~g~l~C~~CG~~m~~~~~~-~~~~yy~C~~~~~   34 (58)
T PF13408_consen    3 SGLLRCGHCGSKMTRRKRK-GKYRYYRCSNRRR   34 (58)
T ss_pred             CCcEEcccCCcEeEEEECC-CCceEEEcCCCcC
Confidence            3579999999998875432 3447899986653


No 55 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=52.57  E-value=7.5  Score=24.19  Aligned_cols=25  Identities=20%  Similarity=0.554  Sum_probs=18.3

Q ss_pred             eecCCCCc-EEcCceeEEeCCcEEEEccCCCC
Q 032449           89 VRCCCCRG-YRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        89 ~RC~~C~a-YiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .-|.+|++ +|-+.-      .+|.|.-|+..
T Consensus        21 ~fCP~Cg~~~m~~~~------~r~~C~~Cgyt   46 (50)
T PRK00432         21 KFCPRCGSGFMAEHL------DRWHCGKCGYT   46 (50)
T ss_pred             CcCcCCCcchheccC------CcEECCCcCCE
Confidence            47999998 554432      58999999864


No 56 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=52.45  E-value=7.8  Score=30.92  Aligned_cols=24  Identities=33%  Similarity=0.779  Sum_probs=19.1

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -..|..|+.         ..++.|.|+-||...
T Consensus       309 S~~C~~cg~---------~~~r~~~C~~cg~~~  332 (364)
T COG0675         309 SKTCPCCGH---------LSGRLFKCPRCGFVH  332 (364)
T ss_pred             cccccccCC---------ccceeEECCCCCCee
Confidence            378999988         336799999999854


No 57 
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=52.33  E-value=9.7  Score=25.15  Aligned_cols=31  Identities=23%  Similarity=0.358  Sum_probs=16.6

Q ss_pred             eeecCCCCcEEcCc----eeEE-----eCCcEEEEccCCC
Q 032449           88 LVRCCCCRGYRNPF----MEFV-----DNGKSFVCNFCGV  118 (140)
Q Consensus        88 ~~RC~~C~aYiNPf----~~~~-----~~g~~w~C~lC~~  118 (140)
                      -.-|++|++++=|-    .++.     ...-.|+|..|++
T Consensus        46 r~~Ck~C~~~liPG~~~~vri~~~~~~~~~l~~~C~~C~~   85 (85)
T PF04032_consen   46 RTICKKCGSLLIPGVNCSVRIRKKKKKKNFLVYTCLNCGH   85 (85)
T ss_dssp             CTB-TTT--B--CTTTEEEEEE---SSS-EEEEEETTTTE
T ss_pred             cccccCCCCEEeCCCccEEEEEecCCCCCEEEEEccccCC
Confidence            45799999998874    3333     2334688999974


No 58 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=52.18  E-value=7.5  Score=22.17  Aligned_cols=11  Identities=36%  Similarity=0.926  Sum_probs=9.4

Q ss_pred             EEEEccCCCCC
Q 032449          110 SFVCNFCGVWM  120 (140)
Q Consensus       110 ~w~C~lC~~~N  120 (140)
                      .|+|..||.+-
T Consensus         2 ~~~C~~CG~i~   12 (34)
T cd00729           2 VWVCPVCGYIH   12 (34)
T ss_pred             eEECCCCCCEe
Confidence            69999999774


No 59 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=51.64  E-value=7.4  Score=24.22  Aligned_cols=32  Identities=25%  Similarity=0.609  Sum_probs=25.6

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      +.+|.+|++=-.|.-.-...|....||.|+..
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~   34 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLY   34 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHH
Confidence            46899999888887766666777999999843


No 60 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=51.08  E-value=8.4  Score=29.90  Aligned_cols=14  Identities=43%  Similarity=0.942  Sum_probs=9.6

Q ss_pred             CCcEEEEccCCCCC
Q 032449          107 NGKSFVCNFCGVWM  120 (140)
Q Consensus       107 ~g~~w~C~lC~~~N  120 (140)
                      +|+.|+|..||..-
T Consensus       131 ~~~~~vC~vCGy~~  144 (166)
T COG1592         131 EGKVWVCPVCGYTH  144 (166)
T ss_pred             cCCEEEcCCCCCcc
Confidence            34578888887654


No 61 
>PF13831 PHD_2:  PHD-finger; PDB: 2L43_A 2KU3_A.
Probab=51.04  E-value=2.3  Score=24.67  Aligned_cols=32  Identities=22%  Similarity=0.430  Sum_probs=14.4

Q ss_pred             CCeeecCCCCcEEcCceeE---EeCCcEEEEccCC
Q 032449           86 SGLVRCCCCRGYRNPFMEF---VDNGKSFVCNFCG  117 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~---~~~g~~w~C~lC~  117 (140)
                      ..+++|++|.-.+.-.|.-   ...+..|.|..|.
T Consensus         2 n~ll~C~~C~v~VH~~CYGv~~~~~~~~W~C~~C~   36 (36)
T PF13831_consen    2 NPLLFCDNCNVAVHQSCYGVSEVPDGDDWLCDRCE   36 (36)
T ss_dssp             CEEEE-SSS--EEEHHHHT-SS--SS-----HHH-
T ss_pred             CceEEeCCCCCcCChhhCCcccCCCCCcEECCcCC
Confidence            3579999999999954421   1234469998773


No 62 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=50.05  E-value=9  Score=20.84  Aligned_cols=27  Identities=19%  Similarity=0.567  Sum_probs=14.9

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      .|.+|+.++-....  .+...+.|+-|..
T Consensus         3 ~C~rC~~~~~~~~~--~~r~~~~C~rCq~   29 (30)
T PF06827_consen    3 KCPRCWNYIEDIGI--NGRSTYLCPRCQK   29 (30)
T ss_dssp             B-TTT--BBEEEEE--TTEEEEE-TTTCC
T ss_pred             cCccCCCcceEeEe--cCCCCeECcCCcC
Confidence            58999998654432  3445789988864


No 63 
>KOG2846 consensus Predicted membrane protein [Function unknown]
Probab=49.62  E-value=12  Score=31.98  Aligned_cols=36  Identities=14%  Similarity=0.219  Sum_probs=23.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      -+-|++|+.==+-.-+-+..--.|+|..|++.|.=+
T Consensus       220 ALIC~~C~~HNGla~~ee~~yi~F~C~~Cn~LN~~~  255 (328)
T KOG2846|consen  220 ALICSQCHHHNGLARKEEYEYITFRCPHCNALNPAK  255 (328)
T ss_pred             hhcchhhccccCcCChhhcCceEEECccccccCCCc
Confidence            367898886544333222333589999999999654


No 64 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=49.26  E-value=16  Score=22.13  Aligned_cols=25  Identities=20%  Similarity=0.360  Sum_probs=11.8

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      +|.+|++-+..-     .+..-+|+-||+.
T Consensus         4 ~C~~Cg~~~~~~-----~~~~irC~~CG~r   28 (44)
T smart00659        4 ICGECGRENEIK-----SKDVVRCRECGYR   28 (44)
T ss_pred             ECCCCCCEeecC-----CCCceECCCCCce
Confidence            455555543321     2344555555543


No 65 
>TIGR00416 sms DNA repair protein RadA. The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
Probab=49.08  E-value=8.7  Score=33.86  Aligned_cols=30  Identities=17%  Similarity=0.318  Sum_probs=23.4

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      ..-+|++|+        +....+.|+|+-|+..|.+..
T Consensus         6 ~~y~C~~Cg--------~~~~~~~g~Cp~C~~w~t~~~   35 (454)
T TIGR00416         6 SKFVCQHCG--------ADSPKWQGKCPACHAWNTITE   35 (454)
T ss_pred             CeEECCcCC--------CCCccccEECcCCCCccccch
Confidence            346777776        455667899999999998866


No 66 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=48.37  E-value=12  Score=27.74  Aligned_cols=34  Identities=18%  Similarity=0.375  Sum_probs=20.9

Q ss_pred             CeeecCCCCcEEcCce-e------------EEe--CCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFM-E------------FVD--NGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~-~------------~~~--~g~~w~C~lC~~~N  120 (140)
                      ...||..|+.....-- +            +..  ....+.|+-||..+
T Consensus        69 ~~~~C~~CG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~~  117 (135)
T PRK03824         69 AVLKCRNCGNEWSLKEVKESLDEEIREAIHFIPEVVHAFLKCPKCGSRD  117 (135)
T ss_pred             eEEECCCCCCEEecccccccccccccccccccccccccCcCCcCCCCCC
Confidence            4689999996544320 0            000  03568899999764


No 67 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=48.18  E-value=7.1  Score=20.35  Aligned_cols=13  Identities=15%  Similarity=0.498  Sum_probs=11.0

Q ss_pred             EEEEccCCCCCCC
Q 032449          110 SFVCNFCGVWMLM  122 (140)
Q Consensus       110 ~w~C~lC~~~N~l  122 (140)
                      .|+|..|...|.-
T Consensus         2 ~W~C~~C~~~N~~   14 (26)
T smart00547        2 DWECPACTFLNFA   14 (26)
T ss_pred             cccCCCCCCcChh
Confidence            5999999998854


No 68 
>PF12773 DZR:  Double zinc ribbon
Probab=48.12  E-value=7.1  Score=23.42  Aligned_cols=30  Identities=17%  Similarity=0.223  Sum_probs=22.2

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWML  121 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~  121 (140)
                      +-..|.+|++-|.     ......++|.-|+..+.
T Consensus        11 ~~~fC~~CG~~l~-----~~~~~~~~C~~Cg~~~~   40 (50)
T PF12773_consen   11 DAKFCPHCGTPLP-----PPDQSKKICPNCGAENP   40 (50)
T ss_pred             cccCChhhcCChh-----hccCCCCCCcCCcCCCc
Confidence            3578888888887     34456788999988763


No 69 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=47.96  E-value=9.2  Score=27.92  Aligned_cols=33  Identities=18%  Similarity=0.179  Sum_probs=19.7

Q ss_pred             CeeecCCCCcEEcCc-eeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPF-MEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf-~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...|| +|+.+...- ...+.-.-.|.|+-||..+
T Consensus        69 ~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~~  102 (124)
T PRK00762         69 VEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNKR  102 (124)
T ss_pred             eeEEe-eCcCcccccccchhccccCCcCcCCCCCC
Confidence            45899 999775432 1111111137899999654


No 70 
>PRK12860 transcriptional activator FlhC; Provisional
Probab=47.65  E-value=9.4  Score=30.25  Aligned_cols=30  Identities=37%  Similarity=0.853  Sum_probs=21.9

Q ss_pred             CCCeeecCCCCc-EEcCceeEEeCCcEEEEccCC
Q 032449           85 ESGLVRCCCCRG-YRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        85 ~~~~~RC~~C~a-YiNPf~~~~~~g~~w~C~lC~  117 (140)
                      ...+.+|++|++ ||-.   ..+....++|++|.
T Consensus       131 ~L~l~~C~~Cgg~fv~~---~~e~~~~f~CplC~  161 (189)
T PRK12860        131 MLQLARCCRCGGKFVTH---AHDLRHNFVCGLCQ  161 (189)
T ss_pred             CeeeccCCCCCCCeecc---ccccCCCCcCCCCC
Confidence            456899999986 5522   22556789999998


No 71 
>PF05280 FlhC:  Flagellar transcriptional activator (FlhC);  InterPro: IPR007944 This family consists of several bacterial flagellar transcriptional activator (FlhC) proteins. FlhC combines with FlhD to form a regulatory complex in Escherichia coli, this complex has been shown to be a global regulator involved in many cellular processes as well as a flagellar transcriptional activator [].; GO: 0003677 DNA binding, 0030092 regulation of flagellum assembly, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2AVU_E.
Probab=46.45  E-value=7  Score=30.43  Aligned_cols=31  Identities=35%  Similarity=0.675  Sum_probs=12.6

Q ss_pred             CCCeeecCCCCc-EEcCceeEEeCCcEEEEccCCC
Q 032449           85 ESGLVRCCCCRG-YRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        85 ~~~~~RC~~C~a-YiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      ...+.+|.+|++ ||..-   .+....++|++|+-
T Consensus       131 ~l~l~~C~~C~~~fv~~~---~~~~~~~~Cp~C~~  162 (175)
T PF05280_consen  131 MLQLAPCRRCGGHFVTHA---HDPRHSFVCPFCQP  162 (175)
T ss_dssp             SEEEEE-TTT--EEEEES---S--SS----TT---
T ss_pred             CccccCCCCCCCCeECcC---CCCCcCcCCCCCCC
Confidence            456799999985 55422   12256899999983


No 72 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=46.31  E-value=8.1  Score=20.91  Aligned_cols=23  Identities=22%  Similarity=0.465  Sum_probs=14.2

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      +|..|++-|+-        ..-+|+.||+..
T Consensus         2 ~CP~C~~~V~~--------~~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPE--------SAKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchh--------hcCcCCCCCCCC
Confidence            46777776632        245677777653


No 73 
>PRK11823 DNA repair protein RadA; Provisional
Probab=46.17  E-value=9.6  Score=33.44  Aligned_cols=29  Identities=21%  Similarity=0.339  Sum_probs=22.7

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      .-+|++|+        +....+.|+|+-|+..|.+..
T Consensus         7 ~y~C~~Cg--------~~~~~~~g~Cp~C~~w~t~~e   35 (446)
T PRK11823          7 AYVCQECG--------AESPKWLGRCPECGAWNTLVE   35 (446)
T ss_pred             eEECCcCC--------CCCcccCeeCcCCCCccceee
Confidence            46777776        455667899999999998865


No 74 
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=46.01  E-value=14  Score=22.57  Aligned_cols=22  Identities=18%  Similarity=0.471  Sum_probs=14.3

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      ++|..|+  +.|..     |.+|+|..|.
T Consensus         1 I~CDgCg--~~PI~-----G~RykC~~C~   22 (43)
T cd02342           1 IQCDGCG--VLPIT-----GPRYKSKVKE   22 (43)
T ss_pred             CCCCCCC--CCccc-----ccceEeCCCC
Confidence            3566676  33443     6789998875


No 75 
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=43.67  E-value=27  Score=23.33  Aligned_cols=33  Identities=24%  Similarity=0.491  Sum_probs=24.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      -++|..|+   |--+-|......-+|..||..---|
T Consensus        19 ~VkCpdC~---N~q~vFshast~V~C~~CG~~l~~P   51 (67)
T COG2051          19 RVKCPDCG---NEQVVFSHASTVVTCLICGTTLAEP   51 (67)
T ss_pred             EEECCCCC---CEEEEeccCceEEEecccccEEEec
Confidence            48899997   5566677777889999999765333


No 76 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=43.21  E-value=16  Score=20.77  Aligned_cols=13  Identities=23%  Similarity=0.467  Sum_probs=9.0

Q ss_pred             CCCeeecCCCCcE
Q 032449           85 ESGLVRCCCCRGY   97 (140)
Q Consensus        85 ~~~~~RC~~C~aY   97 (140)
                      ..+++||..|+.-
T Consensus        14 ~~~~irC~~CG~R   26 (32)
T PF03604_consen   14 PGDPIRCPECGHR   26 (32)
T ss_dssp             TSSTSSBSSSS-S
T ss_pred             CCCcEECCcCCCe
Confidence            3567899999753


No 77 
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=42.34  E-value=14  Score=26.64  Aligned_cols=37  Identities=16%  Similarity=0.099  Sum_probs=27.8

Q ss_pred             eecCCCCcEEcCce----eEEeCCcEEEEccCCCCCCCCCC
Q 032449           89 VRCCCCRGYRNPFM----EFVDNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        89 ~RC~~C~aYiNPf~----~~~~~g~~w~C~lC~~~N~lp~~  125 (140)
                      --|++|.++|=|..    .+..+.-.|+|--||..--+|-.
T Consensus        57 ~~CkkC~t~Lvpg~n~rvR~~~~~v~vtC~~CG~~~R~p~~   97 (105)
T COG2023          57 TICKKCYTPLVPGKNARVRLRKGRVVVTCLECGTIRRYPYG   97 (105)
T ss_pred             HhccccCcccccCcceEEEEcCCeEEEEecCCCcEEEeccc
Confidence            45999999877654    44455578999999998877643


No 78 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=42.32  E-value=8.1  Score=22.18  Aligned_cols=28  Identities=32%  Similarity=0.701  Sum_probs=17.4

Q ss_pred             cCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           91 CCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        91 C~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      |.+|++==.|.-+-...|....||-|+.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~   28 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGL   28 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHH
Confidence            6777777777777777777778998874


No 79 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=42.16  E-value=15  Score=18.53  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=8.0

Q ss_pred             EEEccCCCCC
Q 032449          111 FVCNFCGVWM  120 (140)
Q Consensus       111 w~C~lC~~~N  120 (140)
                      |.|.+|+..-
T Consensus         1 ~~C~~C~~~f   10 (25)
T PF12874_consen    1 FYCDICNKSF   10 (25)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCCc
Confidence            8999998654


No 80 
>PF14353 CpXC:  CpXC protein
Probab=41.22  E-value=28  Score=24.91  Aligned_cols=23  Identities=17%  Similarity=0.207  Sum_probs=10.7

Q ss_pred             CeeecCCCCcEEc---CceeEEeCCc
Q 032449           87 GLVRCCCCRGYRN---PFMEFVDNGK  109 (140)
Q Consensus        87 ~~~RC~~C~aYiN---Pf~~~~~~g~  109 (140)
                      -..+|.+|++...   |+.-.+...+
T Consensus        37 ~~~~CP~Cg~~~~~~~p~lY~D~~~~   62 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYPLLYHDPEKK   62 (128)
T ss_pred             CEEECCCCCCceecCCCEEEEcCCCC
Confidence            3455555555443   4444444433


No 81 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=40.30  E-value=27  Score=19.95  Aligned_cols=30  Identities=20%  Similarity=0.380  Sum_probs=17.4

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      =|..|+..|=|  +-+..++. .|.-|+....+
T Consensus         3 FCp~C~nlL~p--~~~~~~~~-~C~~C~Y~~~~   32 (35)
T PF02150_consen    3 FCPECGNLLYP--KEDKEKRV-ACRTCGYEEPI   32 (35)
T ss_dssp             BETTTTSBEEE--EEETTTTE-EESSSS-EEE-
T ss_pred             eCCCCCccceE--cCCCccCc-CCCCCCCccCC
Confidence            37777777743  44455445 78888765533


No 82 
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=39.67  E-value=17  Score=24.03  Aligned_cols=23  Identities=22%  Similarity=0.391  Sum_probs=16.8

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ..-|++|+....       + .  +|+.|+...
T Consensus         5 ~~AC~~C~~i~~-------~-~--~Cp~Cgs~~   27 (64)
T PRK06393          5 YRACKKCKRLTP-------E-K--TCPVHGDEK   27 (64)
T ss_pred             hhhHhhCCcccC-------C-C--cCCCCCCCc
Confidence            356999997762       1 1  899999875


No 83 
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=38.85  E-value=53  Score=24.58  Aligned_cols=34  Identities=24%  Similarity=0.580  Sum_probs=26.4

Q ss_pred             eeecCCCCcEEcCceeEEeCCcE--EEEccCCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKS--FVCNFCGVWMLMRG  124 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~--w~C~lC~~~N~lp~  124 (140)
                      -+.|+.|+.   |=..+...++.  -.|..||..-.+..
T Consensus       102 yVlC~~C~s---pdT~l~k~~r~~~l~C~ACGa~~~V~~  137 (138)
T PRK03988        102 YVICPECGS---PDTKLIKEGRIWVLKCEACGAETPVKP  137 (138)
T ss_pred             cEECCCCCC---CCcEEEEcCCeEEEEcccCCCCCcCCc
Confidence            489999996   77777776664  57999999887643


No 84 
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=37.14  E-value=21  Score=27.28  Aligned_cols=31  Identities=26%  Similarity=0.406  Sum_probs=21.2

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWML  121 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~  121 (140)
                      .+--|.+|++-+.--    .+.-.|.||+|...-.
T Consensus        88 q~r~CARCGGrv~lr----sNKv~wvcnlc~k~q~  118 (169)
T KOG3799|consen   88 QTRFCARCGGRVSLR----SNKVMWVCNLCRKQQE  118 (169)
T ss_pred             hhhHHHhcCCeeeec----cCceEEeccCCcHHHH
Confidence            345578898876533    3445899999986543


No 85 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=36.93  E-value=25  Score=25.73  Aligned_cols=28  Identities=18%  Similarity=0.267  Sum_probs=20.5

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      .-.+|..|..++-+-.      ..+.|+.|+..+
T Consensus        69 ~~~~C~~C~~~~~~e~------~~~~CP~C~s~~   96 (115)
T COG0375          69 AECWCLDCGQEVELEE------LDYRCPKCGSIN   96 (115)
T ss_pred             cEEEeccCCCeecchh------heeECCCCCCCc
Confidence            3589999977766543      345699999766


No 86 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=36.34  E-value=32  Score=28.21  Aligned_cols=28  Identities=21%  Similarity=0.390  Sum_probs=19.0

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      --|.+|++-|-  ....-+..+|.|+.|..
T Consensus       245 ~pCprCG~~I~--~~~~~gR~t~~CP~CQ~  272 (272)
T PRK14810        245 EPCLNCKTPIR--RVVVAGRSSHYCPHCQK  272 (272)
T ss_pred             CcCCCCCCeeE--EEEECCCccEECcCCcC
Confidence            35889998772  22334567899999963


No 87 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=36.32  E-value=28  Score=20.86  Aligned_cols=29  Identities=21%  Similarity=0.527  Sum_probs=20.4

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      ..+..|..|+..|-.     .....++|..|+..
T Consensus         9 ~~~~~C~~C~~~i~g-----~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWG-----LGKQGYRCSWCGLV   37 (53)
T ss_dssp             SSTEB-TTSSSBECS-----SSSCEEEETTTT-E
T ss_pred             CCCCCCcccCcccCC-----CCCCeEEECCCCCh
Confidence            457899999999922     34567999999853


No 88 
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the PF15288 zf-CCHC_6:  Zinc knuckle
Probab=35.49  E-value=14  Score=22.22  Aligned_cols=11  Identities=27%  Similarity=0.887  Sum_probs=8.6

Q ss_pred             eecCCCCcEEc
Q 032449           89 VRCCCCRGYRN   99 (140)
Q Consensus        89 ~RC~~C~aYiN   99 (140)
                      .||.+|++|=+
T Consensus         2 ~kC~~CG~~GH   12 (40)
T PF15288_consen    2 VKCKNCGAFGH   12 (40)
T ss_pred             ccccccccccc
Confidence            58999999743


No 90 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=34.96  E-value=18  Score=33.56  Aligned_cols=25  Identities=24%  Similarity=0.410  Sum_probs=18.9

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      -.+-+|..|+ |+        .|..|.|+.||..
T Consensus       624 ~~~~~C~~CG-~~--------~g~~~~CP~CG~~  648 (656)
T PRK08270        624 PTFSICPKHG-YL--------SGEHEFCPKCGEE  648 (656)
T ss_pred             CCCcccCCCC-Cc--------CCCCCCCcCCcCc
Confidence            3567899998 44        3568999999944


No 91 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=34.65  E-value=14  Score=25.09  Aligned_cols=14  Identities=36%  Similarity=0.657  Sum_probs=5.4

Q ss_pred             cEEEEccCCCCCCC
Q 032449          109 KSFVCNFCGVWMLM  122 (140)
Q Consensus       109 ~~w~C~lC~~~N~l  122 (140)
                      +.|.|++|++.+.+
T Consensus        21 ~~F~CPfC~~~~sV   34 (81)
T PF05129_consen   21 KVFDCPFCNHEKSV   34 (81)
T ss_dssp             S----TTT--SS-E
T ss_pred             ceEcCCcCCCCCeE
Confidence            57899999988754


No 92 
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=34.56  E-value=57  Score=25.70  Aligned_cols=33  Identities=24%  Similarity=0.569  Sum_probs=26.2

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEE--EEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSF--VCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w--~C~lC~~~N~lp  123 (140)
                      -+.|..|+.   |=..+...++.|  .|..||..-.+.
T Consensus        98 yV~C~~C~~---pdT~l~k~~~~~~l~C~aCGa~~~v~  132 (201)
T PRK12336         98 YVICSECGL---PDTRLVKEDRVLMLRCDACGAHRPVK  132 (201)
T ss_pred             eEECCCCCC---CCcEEEEcCCeEEEEcccCCCCcccc
Confidence            488999995   777777756654  799999888775


No 93 
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=34.47  E-value=23  Score=25.82  Aligned_cols=31  Identities=23%  Similarity=0.432  Sum_probs=24.4

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      .-.-+|..|+..+--..+.  ...++.|..|+.
T Consensus       121 ~~~~~C~~C~~~~~r~~~~--~~~~~~C~~C~~  151 (157)
T PF10263_consen  121 KYVYRCPSCGREYKRHRRS--KRKRYRCGRCGG  151 (157)
T ss_pred             ceEEEcCCCCCEeeeeccc--chhhEECCCCCC
Confidence            4578999999888777666  456899999983


No 94 
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=33.88  E-value=20  Score=25.87  Aligned_cols=14  Identities=36%  Similarity=0.712  Sum_probs=11.2

Q ss_pred             cEEEEccCCCCCCC
Q 032449          109 KSFVCNFCGVWMLM  122 (140)
Q Consensus       109 ~~w~C~lC~~~N~l  122 (140)
                      ++|.|++|++.+..
T Consensus        21 k~FtCp~Cghe~vs   34 (104)
T COG4888          21 KTFTCPRCGHEKVS   34 (104)
T ss_pred             ceEecCccCCeeee
Confidence            68999999988744


No 95 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=33.19  E-value=29  Score=20.17  Aligned_cols=11  Identities=27%  Similarity=0.667  Sum_probs=5.8

Q ss_pred             CeeecCCCCcE
Q 032449           87 GLVRCCCCRGY   97 (140)
Q Consensus        87 ~~~RC~~C~aY   97 (140)
                      .+-+|.+|++.
T Consensus        18 ~id~C~~C~G~   28 (41)
T PF13453_consen   18 EIDVCPSCGGI   28 (41)
T ss_pred             EEEECCCCCeE
Confidence            34555555554


No 96 
>PRK05580 primosome assembly protein PriA; Validated
Probab=33.06  E-value=52  Score=30.48  Aligned_cols=38  Identities=16%  Similarity=0.352  Sum_probs=20.4

Q ss_pred             eeecCCCCcEE-cCcee----EEeCCcEEEEccCCCCCCCCCC
Q 032449           88 LVRCCCCRGYR-NPFME----FVDNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        88 ~~RC~~C~aYi-NPf~~----~~~~g~~w~C~lC~~~N~lp~~  125 (140)
                      .++|.+|+.-+ +|.|.    +....+.-+|..||..-.+|..
T Consensus       381 ~~~C~~Cg~~~~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~  423 (679)
T PRK05580        381 FLLCRDCGWVAECPHCDASLTLHRFQRRLRCHHCGYQEPIPKA  423 (679)
T ss_pred             ceEhhhCcCccCCCCCCCceeEECCCCeEECCCCcCCCCCCCC
Confidence            45555555433 23332    2234566777777777666543


No 97 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=32.65  E-value=14  Score=26.45  Aligned_cols=28  Identities=29%  Similarity=0.407  Sum_probs=18.3

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ...||..|+.-..+--      ..+.|+.|+..+
T Consensus        69 ~~~~C~~Cg~~~~~~~------~~~~CP~Cgs~~   96 (113)
T PF01155_consen   69 ARARCRDCGHEFEPDE------FDFSCPRCGSPD   96 (113)
T ss_dssp             -EEEETTTS-EEECHH------CCHH-SSSSSS-
T ss_pred             CcEECCCCCCEEecCC------CCCCCcCCcCCC
Confidence            4589999998766542      336799999875


No 98 
>PRK11827 hypothetical protein; Provisional
Probab=32.45  E-value=41  Score=21.84  Aligned_cols=33  Identities=15%  Similarity=0.509  Sum_probs=24.9

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      .|+.|..|++=+-    ++.+....+|..|+...++.
T Consensus         7 eILaCP~ckg~L~----~~~~~~~Lic~~~~laYPI~   39 (60)
T PRK11827          7 EIIACPVCNGKLW----YNQEKQELICKLDNLAFPLR   39 (60)
T ss_pred             hheECCCCCCcCe----EcCCCCeEECCccCeecccc
Confidence            5889999998553    34556789999999776654


No 99 
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=31.89  E-value=26  Score=21.41  Aligned_cols=22  Identities=32%  Similarity=0.839  Sum_probs=14.3

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      ++|..|+.  .|.    . |.+|+|..|.
T Consensus         1 i~C~~C~~--~~i----~-g~R~~C~~C~   22 (49)
T cd02338           1 VSCDGCGK--SNF----T-GRRYKCLICY   22 (49)
T ss_pred             CCCCCCcC--CCc----E-EeeEEeCCCC
Confidence            46777773  111    1 5789999885


No 100
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=31.54  E-value=73  Score=18.97  Aligned_cols=28  Identities=21%  Similarity=0.384  Sum_probs=15.6

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFC  116 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC  116 (140)
                      =.+|..|+.-|+.---+..++ +..|.-|
T Consensus        26 Cf~C~~C~~~l~~~~~~~~~~-~~~C~~c   53 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGDFYEKDG-KPYCKDC   53 (58)
T ss_dssp             TSBETTTTCBTTTSSEEEETT-EEEEHHH
T ss_pred             ccccCCCCCccCCCeeEeECC-EEECHHH
Confidence            356777777776554333333 5666544


No 101
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=31.33  E-value=27  Score=31.56  Aligned_cols=26  Identities=19%  Similarity=0.295  Sum_probs=12.3

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ..+-+|.+|+-        ...+ .+.|+.||..|
T Consensus       489 ~~~~~C~~CG~--------~~~~-~~~CP~CGs~~  514 (546)
T PF13597_consen  489 PPIDICPDCGY--------IGGE-GDKCPKCGSEN  514 (546)
T ss_dssp             --EEEETTT-----------S---EEE-CCC----
T ss_pred             cCcccccCCCc--------CCCC-CCCCCCCCCcc
Confidence            34678999983        2233 89999999987


No 102
>PHA00626 hypothetical protein
Probab=31.29  E-value=48  Score=21.50  Aligned_cols=30  Identities=20%  Similarity=0.347  Sum_probs=18.6

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~~  125 (140)
                      ..++||..|+.          ....|+|.-|+....-..+
T Consensus         9 ~~Ivrcg~cr~----------~snrYkCkdCGY~ft~~~~   38 (59)
T PHA00626          9 GNIAKEKTMRG----------WSDDYVCCDCGYNDSKDAF   38 (59)
T ss_pred             ceeeeeceecc----------cCcceEcCCCCCeechhhh
Confidence            34566665542          2467999999976644433


No 103
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=31.02  E-value=26  Score=19.62  Aligned_cols=27  Identities=30%  Similarity=0.619  Sum_probs=12.9

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .+.|..|++=-+=     .++..|+|+-|++.
T Consensus         2 ~p~Cp~C~se~~y-----~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    2 LPKCPLCGSEYTY-----EDGELLVCPECGHE   28 (30)
T ss_dssp             S---TTT-----E-----E-SSSEEETTTTEE
T ss_pred             CCCCCCCCCccee-----ccCCEEeCCccccc
Confidence            3567777653221     34578999999863


No 104
>PF08879 WRC:  WRC;  InterPro: IPR014977 WRC is named after the conserved Trp-Arg-Cys motif, it contains two distinctive features: a putative nuclear localisation signal and a zinc-finger motif (C3H). It is suggested that WRC functions in DNA binding []. ; GO: 0005515 protein binding
Probab=30.92  E-value=23  Score=21.81  Aligned_cols=9  Identities=33%  Similarity=1.058  Sum_probs=7.5

Q ss_pred             eCCcEEEEc
Q 032449          106 DNGKSFVCN  114 (140)
Q Consensus       106 ~~g~~w~C~  114 (140)
                      .+|++|.|.
T Consensus        10 ~DGK~WrC~   18 (46)
T PF08879_consen   10 NDGKGWRCS   18 (46)
T ss_pred             CCCCccccC
Confidence            568999997


No 105
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=30.77  E-value=24  Score=23.04  Aligned_cols=21  Identities=24%  Similarity=0.627  Sum_probs=15.3

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -|++|+..+.      .  .  +|+.|+...
T Consensus         5 AC~~C~~i~~------~--~--~CP~Cgs~~   25 (61)
T PRK08351          5 ACRHCHYITT------E--D--RCPVCGSRD   25 (61)
T ss_pred             hhhhCCcccC------C--C--cCCCCcCCc
Confidence            5889987772      1  1  599999765


No 106
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=30.68  E-value=57  Score=26.72  Aligned_cols=32  Identities=19%  Similarity=0.311  Sum_probs=23.1

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      -|.+|++=|--  ...-+..+|.|+-|...-++.
T Consensus       237 pC~~Cg~~I~~--~~~~gR~ty~Cp~CQ~~~~~~  268 (269)
T PRK14811        237 PCPRCGTPIEK--IVVGGRGTHFCPQCQPLRPLR  268 (269)
T ss_pred             CCCcCCCeeEE--EEECCCCcEECCCCcCCCCCC
Confidence            49999987743  223356799999999876553


No 107
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=30.06  E-value=38  Score=20.17  Aligned_cols=21  Identities=38%  Similarity=0.950  Sum_probs=14.6

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      +.|..|+.   |.     .|.+|+|..|.
T Consensus         1 v~Cd~C~~---~i-----~G~ry~C~~C~   21 (43)
T cd02340           1 VICDGCQG---PI-----VGVRYKCLVCP   21 (43)
T ss_pred             CCCCCCCC---cC-----cCCeEECCCCC
Confidence            35777877   22     25689999886


No 108
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=30.01  E-value=50  Score=26.94  Aligned_cols=27  Identities=19%  Similarity=0.338  Sum_probs=19.3

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      -|.+|++=|--  ....+..+|.|+.|..
T Consensus       247 pC~~Cg~~I~~--~~~~gR~t~~CP~CQ~  273 (274)
T PRK01103        247 PCRRCGTPIEK--IKQGGRSTFFCPRCQK  273 (274)
T ss_pred             CCCCCCCeeEE--EEECCCCcEECcCCCC
Confidence            39999987742  2333567999999975


No 109
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=29.33  E-value=23  Score=32.77  Aligned_cols=27  Identities=22%  Similarity=0.423  Sum_probs=19.9

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ..+-+|..|+ |+       ..|..|.|+.||..+
T Consensus       564 ~~~~iC~~CG-~~-------~~g~~~~CP~CGs~~  590 (623)
T PRK08271        564 VKITICNDCH-HI-------DKRTGKRCPICGSEN  590 (623)
T ss_pred             CCCccCCCCC-Cc-------CCCCCcCCcCCCCcc
Confidence            4568899998 44       245679999999754


No 110
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=29.32  E-value=43  Score=21.34  Aligned_cols=26  Identities=38%  Similarity=0.805  Sum_probs=19.5

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ..+..|..|+.+.=|         .-.|..||.-+
T Consensus        25 ~~l~~C~~CG~~~~~---------H~vC~~CG~Y~   50 (57)
T PRK12286         25 PGLVECPNCGEPKLP---------HRVCPSCGYYK   50 (57)
T ss_pred             CcceECCCCCCccCC---------eEECCCCCcCC
Confidence            357889999998766         46788887544


No 111
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=28.79  E-value=50  Score=24.01  Aligned_cols=29  Identities=21%  Similarity=0.435  Sum_probs=19.9

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWML  121 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~  121 (140)
                      ++.|.+|.+-   |..-  +|.-|+|+.|++.-.
T Consensus         2 lp~CP~C~se---ytY~--dg~~~iCpeC~~EW~   30 (109)
T TIGR00686         2 LPPCPKCNSE---YTYH--DGTQLICPSCLYEWN   30 (109)
T ss_pred             CCcCCcCCCc---ceEe--cCCeeECcccccccc
Confidence            4678888742   3322  356899999998764


No 112
>PRK08402 replication factor A; Reviewed
Probab=28.32  E-value=43  Score=28.83  Aligned_cols=44  Identities=20%  Similarity=0.364  Sum_probs=27.1

Q ss_pred             CeeecCCCCcEEcCceeE--EeCCcEEEEccCCCCCCCC------CCCcccccccccc
Q 032449           87 GLVRCCCCRGYRNPFMEF--VDNGKSFVCNFCGVWMLMR------GLSSVEGQLNLLL  136 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~--~~~g~~w~C~lC~~~N~lp------~~~~~~~~~~~~~  136 (140)
                      ...+|..|+=      ++  +.+...|+|.-|+......      .+.+.-|+..+-|
T Consensus       211 ~y~aCp~CnK------kv~~~~~~~~~~Ce~~~~v~p~~ryil~~~l~D~TG~~~vt~  262 (355)
T PRK08402        211 VYDACPECRR------KVDYDPATDTWICPEHGEVEPIKITILDFGLDDGTGYIRVTL  262 (355)
T ss_pred             eEecCCCCCe------EEEEecCCCCEeCCCCCCcCcceeEEEEEEEEcCCCcEEEEE
Confidence            4688988764      34  3455789999998644332      2455556555443


No 113
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=27.88  E-value=41  Score=21.21  Aligned_cols=24  Identities=38%  Similarity=0.860  Sum_probs=17.1

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .+..|..|+.+.=|+         ..|..||.-
T Consensus        25 ~l~~C~~cG~~~~~H---------~vc~~cG~Y   48 (55)
T TIGR01031        25 TLVVCPNCGEFKLPH---------RVCPSCGYY   48 (55)
T ss_pred             cceECCCCCCcccCe---------eECCccCeE
Confidence            578899999976554         566667643


No 114
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.87  E-value=54  Score=29.25  Aligned_cols=20  Identities=15%  Similarity=0.443  Sum_probs=13.1

Q ss_pred             eCCcEEEEccCCCCCCCCCC
Q 032449          106 DNGKSFVCNFCGVWMLMRGL  125 (140)
Q Consensus       106 ~~g~~w~C~lC~~~N~lp~~  125 (140)
                      ...+.-+|..||..-.+|..
T Consensus       236 ~~~~~l~Ch~Cg~~~~~~~~  255 (505)
T TIGR00595       236 KKEGKLRCHYCGYQEPIPKT  255 (505)
T ss_pred             cCCCeEEcCCCcCcCCCCCC
Confidence            34556777777777766643


No 115
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=27.82  E-value=66  Score=18.81  Aligned_cols=12  Identities=25%  Similarity=0.949  Sum_probs=9.4

Q ss_pred             CCcEEEEccCCC
Q 032449          107 NGKSFVCNFCGV  118 (140)
Q Consensus       107 ~g~~w~C~lC~~  118 (140)
                      +...|+|+-|+.
T Consensus        22 g~G~~~C~~Cg~   33 (37)
T smart00778       22 GRGTWFCSVCGA   33 (37)
T ss_pred             CCcCEEeCCCCC
Confidence            445799999975


No 116
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=27.70  E-value=30  Score=32.58  Aligned_cols=25  Identities=28%  Similarity=0.545  Sum_probs=18.5

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      ..+-+|..|+ |+.-.        .|.|+.||..
T Consensus       678 ~~~~~C~~CG-~~~~~--------~~~CP~CG~~  702 (735)
T PRK07111        678 HPVDRCPVCG-YLGVI--------EDKCPKCGST  702 (735)
T ss_pred             CCCeecCCCC-CCCCc--------CccCcCCCCc
Confidence            4568899998 65432        4999999974


No 117
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=27.68  E-value=23  Score=26.26  Aligned_cols=25  Identities=24%  Similarity=0.448  Sum_probs=19.9

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEE
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVC  113 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C  113 (140)
                      ..-+|+.|++|++-+-....  +.|+|
T Consensus        14 ~~y~C~~C~thla~~~dliS--ksf~g   38 (122)
T KOG3399|consen   14 RLYSCAHCKTHLARHDDLIS--KSFRG   38 (122)
T ss_pred             ceEeccCCcccccchhhccc--ccccc
Confidence            36899999999998877764  56666


No 118
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=27.39  E-value=29  Score=20.30  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=7.7

Q ss_pred             CcEEEEccCCCCC
Q 032449          108 GKSFVCNFCGVWM  120 (140)
Q Consensus       108 g~~w~C~lC~~~N  120 (140)
                      +..|+|+.||..-
T Consensus         4 ~~~YkC~~CGniV   16 (36)
T PF06397_consen    4 GEFYKCEHCGNIV   16 (36)
T ss_dssp             TEEEE-TTT--EE
T ss_pred             ccEEEccCCCCEE
Confidence            5689999999764


No 119
>KOG2169 consensus Zn-finger transcription factor [Transcription]
Probab=27.07  E-value=30  Score=31.96  Aligned_cols=42  Identities=17%  Similarity=0.359  Sum_probs=31.0

Q ss_pred             CCeeecCCCCcEEc----CceeEEeCCcEEEEccCCCCCCCCCCCc
Q 032449           86 SGLVRCCCCRGYRN----PFMEFVDNGKSFVCNFCGVWMLMRGLSS  127 (140)
Q Consensus        86 ~~~~RC~~C~aYiN----Pf~~~~~~g~~w~C~lC~~~N~lp~~~~  127 (140)
                      .-+.|+..|+-|=.    .|-.-++..-+|+|.+|.+.-.+.++..
T Consensus       317 ~~P~r~~~CkHlQcFD~~~~lq~n~~~pTW~CPVC~~~~~~e~l~i  362 (636)
T KOG2169|consen  317 SLPARGHTCKHLQCFDALSYLQMNEQKPTWRCPVCQKAAPFEGLII  362 (636)
T ss_pred             ecCCcccccccceecchhhhHHhccCCCeeeCccCCccccccchhh
Confidence            45788888885533    4555567788999999999887766543


No 120
>PRK00420 hypothetical protein; Validated
Probab=27.07  E-value=39  Score=24.59  Aligned_cols=29  Identities=24%  Similarity=0.607  Sum_probs=21.5

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      -.|..|+   .|++++ .+ ....|+.|+..-.+
T Consensus        24 ~~CP~Cg---~pLf~l-k~-g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         24 KHCPVCG---LPLFEL-KD-GEVVCPVHGKVYIV   52 (112)
T ss_pred             CCCCCCC---Ccceec-CC-CceECCCCCCeeee
Confidence            5688888   577776 33 48999999986544


No 121
>PF05907 DUF866:  Eukaryotic protein of unknown function (DUF866);  InterPro: IPR008584 This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.; PDB: 1ZSO_B.
Probab=26.92  E-value=51  Score=25.17  Aligned_cols=35  Identities=29%  Similarity=0.578  Sum_probs=20.7

Q ss_pred             eeecCCCCc------EEcCceeEEeCCc------EEEEccCCCCCCC
Q 032449           88 LVRCCCCRG------YRNPFMEFVDNGK------SFVCNFCGVWMLM  122 (140)
Q Consensus        88 ~~RC~~C~a------YiNPf~~~~~~g~------~w~C~lC~~~N~l  122 (140)
                      -+.|.+|+-      |||++-+.+..|.      .|+|-+|++.+.+
T Consensus        30 kvkCt~CgE~~~k~V~i~~~e~~e~~gsrG~aNfv~KCk~C~re~si   76 (161)
T PF05907_consen   30 KVKCTSCGEVHPKWVYINRFEKHEIPGSRGTANFVMKCKFCKRESSI   76 (161)
T ss_dssp             EEEETTSS--EEEEEEE-TT-BEE-TTSS-EESEEE--SSSS--EEE
T ss_pred             EEEECCCCCccCcceEeecceEEecCCCccceEeEecCcCcCCccEE
Confidence            388999985      7888877765433      5899999988866


No 122
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=26.86  E-value=53  Score=19.58  Aligned_cols=22  Identities=27%  Similarity=0.742  Sum_probs=14.1

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      ..|..|+..  |..     |.+|.|..|.
T Consensus         5 ~~C~~C~~~--~i~-----g~Ry~C~~C~   26 (46)
T PF00569_consen    5 YTCDGCGTD--PII-----GVRYHCLVCP   26 (46)
T ss_dssp             CE-SSS-SS--SEE-----SSEEEESSSS
T ss_pred             eECcCCCCC--cCc-----CCeEECCCCC
Confidence            678888872  221     5789999995


No 123
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=26.50  E-value=81  Score=20.46  Aligned_cols=33  Identities=21%  Similarity=0.430  Sum_probs=23.2

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      -++|..|..--   .-|......-.|..|++.=.-|
T Consensus        11 ~VkCp~C~n~q---~vFsha~t~V~C~~Cg~~L~~P   43 (59)
T PRK00415         11 KVKCPDCGNEQ---VVFSHASTVVRCLVCGKTLAEP   43 (59)
T ss_pred             EEECCCCCCeE---EEEecCCcEEECcccCCCcccC
Confidence            38999998654   4455556788999999765333


No 124
>PRK07218 replication factor A; Provisional
Probab=25.94  E-value=34  Score=30.19  Aligned_cols=27  Identities=19%  Similarity=0.142  Sum_probs=20.8

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      .-+-||..|+=-|          .+|+|+.||.....
T Consensus       295 gli~rCP~C~r~v----------~~~~C~~hG~ve~~  321 (423)
T PRK07218        295 GLIERCPECGRVI----------QKGQCRSHGAVEGE  321 (423)
T ss_pred             cceecCcCccccc----------cCCcCCCCCCcCCe
Confidence            4578999998777          24999999976543


No 125
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=25.78  E-value=12  Score=24.16  Aligned_cols=33  Identities=15%  Similarity=0.152  Sum_probs=19.0

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      -+||..|.-.+----..-  --.-+|+-|+..|.+
T Consensus         4 tiRC~~CnKlLa~a~~~~--yle~KCPrCK~vN~~   36 (60)
T COG4416           4 TIRCAKCNKLLAEAEGQA--YLEKKCPRCKEVNEF   36 (60)
T ss_pred             eeehHHHhHHHHhcccce--eeeecCCccceeeee
Confidence            378888875553211000  013578888888865


No 126
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=25.70  E-value=43  Score=17.50  Aligned_cols=12  Identities=33%  Similarity=0.971  Sum_probs=8.7

Q ss_pred             CcEEEEccCCCC
Q 032449          108 GKSFVCNFCGVW  119 (140)
Q Consensus       108 g~~w~C~lC~~~  119 (140)
                      -+.|.|..|+..
T Consensus        12 ~k~~~C~~C~k~   23 (26)
T PF13465_consen   12 EKPYKCPYCGKS   23 (26)
T ss_dssp             SSSEEESSSSEE
T ss_pred             CCCCCCCCCcCe
Confidence            466888888753


No 127
>KOG4784 consensus Uncharacterized conserved protein [Function unknown]
Probab=25.69  E-value=24  Score=30.51  Aligned_cols=35  Identities=17%  Similarity=0.246  Sum_probs=27.6

Q ss_pred             CCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           85 ESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        85 ~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ..+.+-|++|+++++-++.-+.... |.|.+|...-
T Consensus       181 ~~d~~~C~rC~~~lg~~~~~~~~n~-v~~~~~~v~~  215 (348)
T KOG4784|consen  181 GNDRVLCSRCKRCLGLFITKDVYNQ-VADALCFVTL  215 (348)
T ss_pred             CCCchhhhhhHhhcCcccccchhhh-eecccceEEc
Confidence            3567899999999999876666544 9999997544


No 128
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=25.57  E-value=57  Score=24.22  Aligned_cols=27  Identities=22%  Similarity=0.560  Sum_probs=18.4

Q ss_pred             eeecCCCCcEEcCceeEEeCC-cEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNG-KSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g-~~w~C~lC~~~N  120 (140)
                      -..|..|+-=+      ...+ ..|.|.-|+...
T Consensus        34 Y~aC~~C~kkv------~~~~~~~~~C~~C~~~~   61 (166)
T cd04476          34 YPACPGCNKKV------VEEGNGTYRCEKCNKSV   61 (166)
T ss_pred             EccccccCccc------EeCCCCcEECCCCCCcC
Confidence            36777776533      3333 689999999874


No 129
>PHA02942 putative transposase; Provisional
Probab=25.54  E-value=43  Score=28.95  Aligned_cols=29  Identities=24%  Similarity=0.311  Sum_probs=21.1

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      .--.|..|+...-     ...++.|+|.-||...
T Consensus       324 TSq~Cs~CG~~~~-----~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMV-----EIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccC-----cCCCCEEECCCCCCEe
Confidence            3478999998542     2245789999999864


No 130
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=25.44  E-value=21  Score=22.09  Aligned_cols=29  Identities=24%  Similarity=0.534  Sum_probs=17.5

Q ss_pred             ecCCCCcEEcC--ceeEEeCCcEEEEccCCC
Q 032449           90 RCCCCRGYRNP--FMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        90 RC~~C~aYiNP--f~~~~~~g~~w~C~lC~~  118 (140)
                      +|..|+--|.|  +..+..+.....|+-|+.
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCc
Confidence            67777777766  334433335667777765


No 131
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=25.11  E-value=77  Score=20.27  Aligned_cols=27  Identities=22%  Similarity=0.437  Sum_probs=21.1

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      .+-+|.+|+.|==          +-+|+.||.....+
T Consensus         4 ~mr~C~~CgvYTL----------k~~CP~CG~~t~~~   30 (56)
T PRK13130          4 KIRKCPKCGVYTL----------KEICPVCGGKTKNP   30 (56)
T ss_pred             cceECCCCCCEEc----------cccCcCCCCCCCCC
Confidence            4788999999832          56899999877665


No 132
>COG1773 Rubredoxin [Energy production and conversion]
Probab=25.09  E-value=42  Score=21.52  Aligned_cols=17  Identities=41%  Similarity=0.790  Sum_probs=11.5

Q ss_pred             eeEEeCCcEEEEccCCC
Q 032449          102 MEFVDNGKSFVCNFCGV  118 (140)
Q Consensus       102 ~~~~~~g~~w~C~lC~~  118 (140)
                      ..|.+--..|.|+.|+.
T Consensus        28 T~fedlPd~w~CP~Cg~   44 (55)
T COG1773          28 TPFEDLPDDWVCPECGV   44 (55)
T ss_pred             CchhhCCCccCCCCCCC
Confidence            33444445799999995


No 133
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=24.88  E-value=15  Score=23.11  Aligned_cols=28  Identities=32%  Similarity=0.720  Sum_probs=20.8

Q ss_pred             cCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           91 CCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        91 C~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      |.+|++--.|.-.-...+..-.||.|+.
T Consensus         2 C~~C~~~~Tp~WR~g~~~~~~LCNaCgl   29 (54)
T cd00202           2 CSNCGTTTTPLWRRGPSGGSTLCNACGL   29 (54)
T ss_pred             CCCCCCCCCcccccCCCCcchHHHHHHH
Confidence            7888887777666555567788999984


No 134
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=24.63  E-value=65  Score=26.50  Aligned_cols=26  Identities=15%  Similarity=0.275  Sum_probs=18.6

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      -|.+|++=|--  ....+..+|.|+-|.
T Consensus       256 pC~~Cg~~I~~--~~~~gR~t~~CP~CQ  281 (282)
T PRK13945        256 PCRKCGTPIER--IKLAGRSTHWCPNCQ  281 (282)
T ss_pred             CCCcCCCeeEE--EEECCCccEECCCCc
Confidence            58889887752  233466789999986


No 135
>PF14692 DUF4462:  Domain of unknown function (DUF4462)
Probab=24.61  E-value=26  Score=19.52  Aligned_cols=13  Identities=23%  Similarity=0.409  Sum_probs=10.4

Q ss_pred             EeeccccCCCHHH
Q 032449           41 RCSLNQIPCTENL   53 (140)
Q Consensus        41 R~T~~~iP~t~~l   53 (140)
                      |++||.+|+...+
T Consensus         5 r~~WN~LpRag~v   17 (28)
T PF14692_consen    5 RFNWNWLPRAGSV   17 (28)
T ss_pred             ccccccCcccccc
Confidence            7899999987654


No 136
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=24.61  E-value=96  Score=29.41  Aligned_cols=43  Identities=14%  Similarity=0.285  Sum_probs=30.2

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCCCCcccccc
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRGLSSVEGQL  132 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~~~~~~~~~  132 (140)
                      .-+.+|.+|-++|    .+-...+...|-.||+.-.+|..=..=|..
T Consensus       442 g~v~~Cp~Cd~~l----t~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         442 GYIAECPNCDSPL----TLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             CCcccCCCCCcce----EEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            3466777777664    344566899999999998888655544444


No 137
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=24.42  E-value=31  Score=33.35  Aligned_cols=42  Identities=17%  Similarity=0.275  Sum_probs=31.1

Q ss_pred             ccCCCCeeecCCCCcEEcCceeEE------eCCcEEEEccCCCCCCCC
Q 032449           82 DFGESGLVRCCCCRGYRNPFMEFV------DNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        82 ~~~~~~~~RC~~C~aYiNPf~~~~------~~g~~w~C~lC~~~N~lp  123 (140)
                      +.......||+-|.-..+.+....      -+-|-|+||+||....-+
T Consensus       347 ~~~~~~khkCr~CakvfgS~SaLqiHlRSHTGERPfqCnvCG~~FSTk  394 (958)
T KOG1074|consen  347 SEKPFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFQCNVCGNRFSTK  394 (958)
T ss_pred             CccccccchhhhhHhhcCchhhhhhhhhccCCCCCeeecccccccccc
Confidence            334456789999999999765443      356789999999766444


No 138
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=23.84  E-value=57  Score=19.21  Aligned_cols=21  Identities=29%  Similarity=0.735  Sum_probs=14.3

Q ss_pred             ecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           90 RCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        90 RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      ||..|....          ..|+|--|+..-
T Consensus         1 ~C~~C~~~~----------~l~~CL~C~~~~   21 (50)
T smart00290        1 RCSVCGTIE----------NLWLCLTCGQVG   21 (50)
T ss_pred             CcccCCCcC----------CeEEecCCCCcc
Confidence            577777533          279999988543


No 139
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=23.56  E-value=52  Score=23.69  Aligned_cols=34  Identities=24%  Similarity=0.360  Sum_probs=26.1

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      .=|.+|++.|=|--.-  .+..+.|.-|+....+..
T Consensus         3 ~FCp~Cgsll~p~~~~--~~~~l~C~kCgye~~~~~   36 (113)
T COG1594           3 RFCPKCGSLLYPKKDD--EGGKLVCRKCGYEEEASN   36 (113)
T ss_pred             cccCCccCeeEEeEcC--CCcEEECCCCCcchhccc
Confidence            3589999999886543  345999999998887764


No 140
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=23.54  E-value=1.3e+02  Score=25.08  Aligned_cols=38  Identities=16%  Similarity=0.348  Sum_probs=30.9

Q ss_pred             CCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCCC
Q 032449           85 ESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        85 ~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      ....+.|+=|++-|+---+-..  +-.+|+-|+.-..|.+
T Consensus        62 ~~p~v~CrVCq~~I~i~gk~~Q--hVVkC~~CnEATPIr~   99 (256)
T PF09788_consen   62 GAPVVTCRVCQSLIDIEGKMHQ--HVVKCSVCNEATPIRN   99 (256)
T ss_pred             CCceEEeecCCceecccCccce--eeEECCCCCccccccC
Confidence            3468999999999998766654  6899999998887754


No 141
>PRK04351 hypothetical protein; Provisional
Probab=23.53  E-value=84  Score=23.70  Aligned_cols=31  Identities=23%  Similarity=0.304  Sum_probs=21.6

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      -.-||.+|+.-+--.-++  +..++.|..|+..
T Consensus       111 y~Y~C~~Cg~~~~r~Rr~--n~~~yrCg~C~g~  141 (149)
T PRK04351        111 YLYECQSCGQQYLRKRRI--NTKRYRCGKCRGK  141 (149)
T ss_pred             EEEECCCCCCEeeeeeec--CCCcEEeCCCCcE
Confidence            468999998755333333  3478999999854


No 142
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=23.51  E-value=49  Score=16.15  Aligned_cols=10  Identities=30%  Similarity=0.989  Sum_probs=7.7

Q ss_pred             EEEccCCCCC
Q 032449          111 FVCNFCGVWM  120 (140)
Q Consensus       111 w~C~lC~~~N  120 (140)
                      |+|..|+..-
T Consensus         1 y~C~~C~~~f   10 (23)
T PF00096_consen    1 YKCPICGKSF   10 (23)
T ss_dssp             EEETTTTEEE
T ss_pred             CCCCCCCCcc
Confidence            6899998654


No 143
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=23.46  E-value=43  Score=32.90  Aligned_cols=27  Identities=19%  Similarity=0.381  Sum_probs=21.3

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLM  122 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~l  122 (140)
                      ...-||.+|+.|          +-+++|+.||.....
T Consensus       623 v~~RKCPkCG~y----------Tlk~rCP~CG~~Te~  649 (1095)
T TIGR00354       623 IAIRKCPQCGKE----------SFWLKCPVCGELTEQ  649 (1095)
T ss_pred             EEEEECCCCCcc----------cccccCCCCCCcccc
Confidence            456899999998          247899999988643


No 144
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=23.23  E-value=37  Score=22.21  Aligned_cols=19  Identities=47%  Similarity=0.761  Sum_probs=13.0

Q ss_pred             cEEEEccCCCCCCCCCCCcc
Q 032449          109 KSFVCNFCGVWMLMRGLSSV  128 (140)
Q Consensus       109 ~~w~C~lC~~~N~lp~~~~~  128 (140)
                      ++-+||+||. |+-|++.++
T Consensus        29 k~~VCnlCGF-NP~Phl~E~   47 (61)
T PF05715_consen   29 KSQVCNLCGF-NPTPHLTEV   47 (61)
T ss_pred             hhhhhcccCC-CCCcccccc
Confidence            3567999997 446766653


No 145
>COG0266 Nei Formamidopyrimidine-DNA glycosylase [DNA replication, recombination, and repair]
Probab=23.09  E-value=58  Score=27.22  Aligned_cols=28  Identities=18%  Similarity=0.434  Sum_probs=20.2

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGV  118 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~  118 (140)
                      --|++|++-|---.  ..+..+|.|+-|.+
T Consensus       246 epC~~CGt~I~k~~--~~gR~t~~CP~CQ~  273 (273)
T COG0266         246 EPCRRCGTPIEKIK--LGGRSTFYCPVCQK  273 (273)
T ss_pred             CCCCccCCEeEEEE--EcCCcCEeCCCCCC
Confidence            45899999886432  23456899999964


No 146
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=22.80  E-value=25  Score=30.60  Aligned_cols=32  Identities=19%  Similarity=0.248  Sum_probs=23.4

Q ss_pred             CCCCeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           84 GESGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        84 ~~~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      |.+-.--|.+|+.-++|--...   ..|+|+ ||..
T Consensus       236 GKYh~~~c~~C~~~~~~~~~~~---~~~~Cp-CG~~  267 (374)
T TIGR00375       236 GKYHQTACEACGEPAVSEDAET---ACANCP-CGGR  267 (374)
T ss_pred             CccchhhhcccCCcCCchhhhh---cCCCCC-CCCc
Confidence            4566778999988777653332   259999 9987


No 147
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.78  E-value=79  Score=22.42  Aligned_cols=33  Identities=18%  Similarity=0.456  Sum_probs=23.2

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      .+..|.+|+++ .--+.++.+.-.-.|..|+...
T Consensus        20 t~f~CP~Cge~-~v~v~~~k~~~h~~C~~CG~y~   52 (99)
T PRK14892         20 KIFECPRCGKV-SISVKIKKNIAIITCGNCGLYT   52 (99)
T ss_pred             cEeECCCCCCe-EeeeecCCCcceEECCCCCCcc
Confidence            46789889863 4445566666678899998654


No 148
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=22.70  E-value=66  Score=24.11  Aligned_cols=25  Identities=28%  Similarity=0.817  Sum_probs=18.4

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .-|..|++   |.++  .+| .-.|++|++.
T Consensus        29 ~hCp~Cg~---PLF~--KdG-~v~CPvC~~~   53 (131)
T COG1645          29 KHCPKCGT---PLFR--KDG-EVFCPVCGYR   53 (131)
T ss_pred             hhCcccCC---ccee--eCC-eEECCCCCce
Confidence            46889987   5554  554 7999999953


No 149
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=22.36  E-value=56  Score=18.38  Aligned_cols=25  Identities=32%  Similarity=0.482  Sum_probs=13.7

Q ss_pred             CeeecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           87 GLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        87 ~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .+.||.+|+.+.-|        -+-.|+-|+..
T Consensus        10 ~~~rC~~Cg~~~~p--------Pr~~Cp~C~s~   34 (37)
T PF12172_consen   10 LGQRCRDCGRVQFP--------PRPVCPHCGSD   34 (37)
T ss_dssp             EEEE-TTT--EEES----------SEETTTT--
T ss_pred             EEEEcCCCCCEecC--------CCcCCCCcCcc
Confidence            46899999998544        24678888754


No 150
>KOG4623 consensus Uncharacterized conserved protein [Function unknown]
Probab=22.31  E-value=31  Score=31.55  Aligned_cols=34  Identities=21%  Similarity=0.540  Sum_probs=22.0

Q ss_pred             CeeecCCCCcEEc-CceeEEeCCcEEEEccCCCCCCCCC
Q 032449           87 GLVRCCCCRGYRN-PFMEFVDNGKSFVCNFCGVWMLMRG  124 (140)
Q Consensus        87 ~~~RC~~C~aYiN-Pf~~~~~~g~~w~C~lC~~~N~lp~  124 (140)
                      .-+-|.-|+.=.- ||    .+...|+|+.|..-|.+..
T Consensus        27 t~VnCwFCnk~t~vpy----q~rNswTCpsCEQyNgfte   61 (611)
T KOG4623|consen   27 TTVNCWFCNKKTEVPY----QGRNSWTCPSCEQYNGFTE   61 (611)
T ss_pred             ceEEEEEecCcceecc----CCCCCCcCCcHHhhCCCCc
Confidence            3466766643211 33    3567899999999996643


No 151
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=22.18  E-value=63  Score=19.66  Aligned_cols=22  Identities=41%  Similarity=1.028  Sum_probs=14.1

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      ++|..|+..  |.     .|.+|+|..|.
T Consensus         1 V~Cd~C~~~--pI-----~G~RykC~~C~   22 (45)
T cd02344           1 VTCDGCQMF--PI-----NGPRFKCRNCD   22 (45)
T ss_pred             CCCCCCCCC--CC-----ccCeEECCCCC
Confidence            356777643  22     25789998887


No 152
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=21.83  E-value=41  Score=24.78  Aligned_cols=36  Identities=17%  Similarity=0.395  Sum_probs=22.4

Q ss_pred             eeecCCCCcEE-cCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYR-NPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYi-NPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      .+-|..|.++- --.-....+-.+|+|..|+..-.+-
T Consensus        30 ~~~cP~C~s~~~~k~g~~~~~~qRyrC~~C~~tf~~~   66 (129)
T COG3677          30 KVNCPRCKSSNVVKIGGIRRGHQRYKCKSCGSTFTVE   66 (129)
T ss_pred             cCcCCCCCccceeeECCccccccccccCCcCcceeee
Confidence            36677777776 1112222335789999999876553


No 153
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=21.81  E-value=20  Score=23.15  Aligned_cols=17  Identities=18%  Similarity=0.313  Sum_probs=12.0

Q ss_pred             eCCcEEEEccCCCCCCC
Q 032449          106 DNGKSFVCNFCGVWMLM  122 (140)
Q Consensus       106 ~~g~~w~C~lC~~~N~l  122 (140)
                      .-....+|+-|++..+|
T Consensus        49 i~eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   49 IVEGELICPECGREYPI   65 (68)
T ss_dssp             TTTTEEEETTTTEEEEE
T ss_pred             ccCCEEEcCCCCCEEeC
Confidence            33458999999876644


No 154
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=21.55  E-value=79  Score=18.86  Aligned_cols=24  Identities=33%  Similarity=0.836  Sum_probs=16.3

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCG  117 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~  117 (140)
                      -.|..|+   .|.++ +.+| +-.|..|+
T Consensus        18 ~~Cp~C~---~PL~~-~k~g-~~~Cv~C~   41 (41)
T PF06677_consen   18 EHCPDCG---TPLMR-DKDG-KIYCVSCG   41 (41)
T ss_pred             CccCCCC---CeeEE-ecCC-CEECCCCC
Confidence            3577785   67776 4554 67899885


No 155
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=21.44  E-value=36  Score=22.50  Aligned_cols=23  Identities=22%  Similarity=0.605  Sum_probs=16.8

Q ss_pred             eecCCCCcEEcCceeEEeCCcEEEEccCCCC
Q 032449           89 VRCCCCRGYRNPFMEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        89 ~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~  119 (140)
                      .-|++|+..++.        .+=+|+.|+..
T Consensus         5 kAC~~Ck~l~~~--------d~e~CP~Cgs~   27 (64)
T COG2093           5 KACKNCKRLTPE--------DTEICPVCGST   27 (64)
T ss_pred             HHHhhccccCCC--------CCccCCCCCCc
Confidence            358889877653        35679999865


No 156
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=21.38  E-value=62  Score=21.05  Aligned_cols=26  Identities=23%  Similarity=0.474  Sum_probs=19.5

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N~lp  123 (140)
                      +-+|.+|+.|-          -+=+|+.||-...+|
T Consensus         5 ~rkC~~cg~YT----------Lke~Cp~CG~~t~~~   30 (59)
T COG2260           5 IRKCPKCGRYT----------LKEKCPVCGGDTKVP   30 (59)
T ss_pred             hhcCcCCCcee----------ecccCCCCCCccccC
Confidence            56899998872          135799999887775


No 157
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=21.24  E-value=74  Score=25.38  Aligned_cols=20  Identities=30%  Similarity=0.477  Sum_probs=16.3

Q ss_pred             CCeeecCCCCcEEcCceeEEe
Q 032449           86 SGLVRCCCCRGYRNPFMEFVD  106 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~  106 (140)
                      ..+..|+.|++|..+ -+|.+
T Consensus        33 i~v~~C~~Cg~~~~~-~~W~~   52 (236)
T PF04981_consen   33 IEVTICPKCGRYRIG-GRWVD   52 (236)
T ss_pred             cCceECCCCCCEECC-CEeee
Confidence            468999999999988 55654


No 158
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=21.24  E-value=54  Score=27.68  Aligned_cols=16  Identities=31%  Similarity=0.858  Sum_probs=14.0

Q ss_pred             eEEeCCcEEEEccCCC
Q 032449          103 EFVDNGKSFVCNFCGV  118 (140)
Q Consensus       103 ~~~~~g~~w~C~lC~~  118 (140)
                      .|+.+||.|+|+||..
T Consensus       135 vw~hGGrif~CsfC~~  150 (314)
T PF06524_consen  135 VWDHGGRIFKCSFCDN  150 (314)
T ss_pred             cccCCCeEEEeecCCC
Confidence            4788999999999984


No 159
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=21.22  E-value=54  Score=26.88  Aligned_cols=18  Identities=28%  Similarity=0.508  Sum_probs=14.7

Q ss_pred             CeeecCCCCc-EEcCceeE
Q 032449           87 GLVRCCCCRG-YRNPFMEF  104 (140)
Q Consensus        87 ~~~RC~~C~a-YiNPf~~~  104 (140)
                      .++||.+|++ .|+|-+.|
T Consensus       145 ~~p~C~~Cg~~~lrP~VV~  163 (250)
T COG0846         145 LIPRCPKCGGPVLRPDVVW  163 (250)
T ss_pred             CCCcCccCCCccccCCEEE
Confidence            4789999999 88887655


No 160
>PRK12366 replication factor A; Reviewed
Probab=20.93  E-value=72  Score=29.45  Aligned_cols=29  Identities=28%  Similarity=0.599  Sum_probs=21.3

Q ss_pred             CCeeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           86 SGLVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        86 ~~~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      .-..+|..|+--|.      .+...|.|.-|+...
T Consensus       530 ~~y~aCp~CnkKv~------~~~g~~~C~~c~~~~  558 (637)
T PRK12366        530 IILYLCPNCRKRVE------EVDGEYICEFCGEVE  558 (637)
T ss_pred             EEEecccccCeEeE------cCCCcEECCCCCCCC
Confidence            34689999966442      345689999999873


No 161
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=20.81  E-value=44  Score=29.60  Aligned_cols=35  Identities=17%  Similarity=0.472  Sum_probs=24.0

Q ss_pred             CCCeeecCCCCcEEcCc-----------eeEEeCCcEEEEccCCCC
Q 032449           85 ESGLVRCCCCRGYRNPF-----------MEFVDNGKSFVCNFCGVW  119 (140)
Q Consensus        85 ~~~~~RC~~C~aYiNPf-----------~~~~~~g~~w~C~lC~~~  119 (140)
                      ....-+|.-|+-.-.|-           ..|++--..|.|+.|+..
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCc
Confidence            34567899999655553           345444457999999954


No 162
>smart00704 ZnF_CDGSH CDGSH-type zinc finger. Function unknown.
Probab=20.44  E-value=1.2e+02  Score=17.74  Aligned_cols=18  Identities=22%  Similarity=0.368  Sum_probs=12.6

Q ss_pred             EeCCcEEEEccCCCCCCCC
Q 032449          105 VDNGKSFVCNFCGVWMLMR  123 (140)
Q Consensus       105 ~~~g~~w~C~lC~~~N~lp  123 (140)
                      +.++..|.|. |+.....|
T Consensus         9 e~~~~~~lC~-C~~S~~~P   26 (38)
T smart00704        9 EKREKYALCR-CGRSKNFP   26 (38)
T ss_pred             cCCCEEEEee-CCCCCCCC
Confidence            3445678887 88877766


No 163
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=20.31  E-value=46  Score=26.76  Aligned_cols=25  Identities=12%  Similarity=0.399  Sum_probs=14.6

Q ss_pred             cEEcCceeEEeCCcEEEEccCCCCCC
Q 032449           96 GYRNPFMEFVDNGKSFVCNFCGVWML  121 (140)
Q Consensus        96 aYiNPf~~~~~~g~~w~C~lC~~~N~  121 (140)
                      .||..+++- .+..+|.|.+|+++..
T Consensus        64 ~~v~~~~~e-~~~~K~~C~lc~KlFk   88 (214)
T PF04959_consen   64 KFVQKNTKE-EDEDKWRCPLCGKLFK   88 (214)
T ss_dssp             GGEEEEE-S-SSSEEEEE-SSS-EES
T ss_pred             HHHHHHHHH-HcCCEECCCCCCcccC
Confidence            455555533 3567999999997653


No 164
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=20.02  E-value=80  Score=23.41  Aligned_cols=25  Identities=24%  Similarity=0.367  Sum_probs=19.9

Q ss_pred             eeecCCCCcEEcCceeEEeCCcEEEEccCCCCC
Q 032449           88 LVRCCCCRGYRNPFMEFVDNGKSFVCNFCGVWM  120 (140)
Q Consensus        88 ~~RC~~C~aYiNPf~~~~~~g~~w~C~lC~~~N  120 (140)
                      -.||.+|+.+.-|=        +-.|.-|+...
T Consensus        29 g~kC~~CG~v~~PP--------r~~Cp~C~~~~   53 (140)
T COG1545          29 GTKCKKCGRVYFPP--------RAYCPKCGSET   53 (140)
T ss_pred             EEEcCCCCeEEcCC--------cccCCCCCCCC
Confidence            48999999987764        45688888885


Done!