Citrus Sinensis ID: 032479

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140

MVSFEMNDRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRVPV

ccCEECccccEEEHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHHccccccc

*******DRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRV**

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVSFEMNDRKKIGLGLTGFGIFFTFLGIIFFFDKGLLAMGNILFIAGVSLTIGLKSTMQFFMKRQNYKGTISFGVGFFFVVIGWPILGMILETYGFIVLFSGFWPTLSVFLQRIPILGWLFQQPFVRSFFDRYRSRRVPV

Annotation	Function Description	Confidence Level	Reference Protein
Vesicle transport protein GOT1B	May be involved in fusion of ER-derived transport vesicles with the Golgi complex.	probable	Q9Y3E0
Protein transport protein got1	Nonessential protein required for the fusion of ER-derived transport vesicles with the Golgi complex. Can be replaced by sft2.	probable	Q9USJ2
Vesicle transport protein GOT1A	May be involved in fusion of ER-derived transport vesicles with the Golgi complex.	probable	Q2NKV8

No EC number assigned to the protein, probably not an enzyme!

No confident structure templates for the query are predicted