Query         032597
Match_columns 137
No_of_seqs    151 out of 366
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 03:30:51 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032597.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032597hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3389 NADH:ubiquinone oxidor 100.0 1.4E-48 2.9E-53  304.1   7.5  115   22-137    42-160 (178)
  2 PF04800 ETC_C1_NDUFA4:  ETC co 100.0 1.1E-44 2.3E-49  264.8   7.6   83   52-137     1-84  (101)
  3 PF09954 DUF2188:  Uncharacteri  86.4    0.53 1.2E-05   30.7   1.9   25  105-129    22-51  (62)
  4 PF08727 P3A:  Poliovirus 3A pr  80.6     1.1 2.3E-05   30.3   1.5   16  112-127    30-45  (57)
  5 PHA02552 4 head completion pro  80.3     1.6 3.4E-05   34.3   2.6   70   52-132    60-141 (151)
  6 PF05573 NosL:  NosL;  InterPro  78.4     2.9 6.3E-05   31.8   3.5   50   72-122    77-135 (149)
  7 PRK05370 argininosuccinate syn  75.6       2 4.3E-05   39.1   2.2   23  106-128   164-186 (447)
  8 PF08722 Tn7_Tnp_TnsA_N:  TnsA   70.1     4.7  0.0001   27.5   2.6   19  111-129    69-87  (88)
  9 PF11360 DUF3110:  Protein of u  68.2       8 0.00017   27.5   3.5   25  107-131    53-77  (86)
 10 PF03462 PCRF:  PCRF domain;  I  62.8     5.5 0.00012   29.1   1.9   15  115-129    73-87  (115)
 11 PF11360 DUF3110:  Protein of u  59.2     8.5 0.00018   27.4   2.3   19   99-120    23-41  (86)
 12 PF08803 ydhR:  Putative mono-o  57.0     7.4 0.00016   28.6   1.7   29   91-121    38-66  (97)
 13 PF07045 DUF1330:  Protein of u  56.1      11 0.00025   24.5   2.3   14  105-118    43-56  (65)
 14 PF06194 Phage_Orf51:  Phage Co  54.9      10 0.00022   27.1   2.0   23  105-127    51-73  (80)
 15 KOG2854 Possible pfkB family c  54.9      10 0.00023   33.5   2.5   21  105-125   216-236 (343)
 16 PRK04527 argininosuccinate syn  54.5     8.6 0.00019   34.4   2.0   22  107-128   150-171 (400)
 17 PF10075 PCI_Csn8:  COP9 signal  54.5     7.1 0.00015   28.8   1.3   20  106-126   107-126 (143)
 18 PF13031 DUF3892:  Protein of u  54.1      12 0.00025   25.8   2.2   23  106-128    28-50  (85)
 19 KOG4748 Subunit of Golgi manno  51.2      11 0.00023   33.6   2.0   23  110-132   127-149 (364)
 20 PF01071 GARS_A:  Phosphoribosy  50.8      17 0.00037   29.3   3.0   25  105-129    20-44  (194)
 21 PF03108 DBD_Tnp_Mut:  MuDR fam  49.8      20 0.00043   23.2   2.7   29  105-133     7-39  (67)
 22 COG3341 Predicted double-stran  49.3      11 0.00024   31.5   1.8   14  107-120    39-52  (225)
 23 PF12518 DUF3721:  Protein of u  48.9      16 0.00035   22.2   2.0   16  108-123     1-16  (34)
 24 PF07862 Nif11:  Nitrogen fixat  47.3     9.7 0.00021   23.5   0.9   21  108-128    26-46  (49)
 25 PF01693 Cauli_VI:  Caulimoviru  46.4      21 0.00046   21.8   2.3   13  105-117    32-44  (44)
 26 PRK11118 putative monooxygenas  45.4      28  0.0006   25.9   3.1   29   91-121    41-69  (100)
 27 PRK05773 3,4-dihydroxy-2-butan  44.4      18 0.00039   29.9   2.3   17  109-125   191-207 (219)
 28 COG0108 RibB 3,4-dihydroxy-2-b  44.3      18 0.00038   29.9   2.2   18  109-126   172-189 (203)
 29 PF02844 GARS_N:  Phosphoribosy  43.2      24 0.00053   25.7   2.6   28  105-132    45-72  (100)
 30 PLN00139 hypothetical protein;  42.5      22 0.00048   30.4   2.6   26  106-131   195-220 (320)
 31 PRK12354 carbamate kinase; Rev  41.5      21 0.00045   30.9   2.3   22  107-128   125-146 (307)
 32 PF03793 PASTA:  PASTA domain;   39.8      32 0.00069   21.6   2.5   22  109-130     9-30  (63)
 33 PF03682 UPF0158:  Uncharacteri  39.3      23 0.00051   27.6   2.1   20  111-130   127-146 (163)
 34 COG0137 ArgG Argininosuccinate  38.8      23  0.0005   32.0   2.2   21  107-128   151-171 (403)
 35 PF05637 Glyco_transf_34:  gala  38.6      20 0.00043   29.2   1.7   17  112-128    31-47  (239)
 36 PF05406 WGR:  WGR domain;  Int  37.1      29 0.00064   23.4   2.1   45   71-120    19-64  (81)
 37 PF00568 WH1:  WH1 domain;  Int  37.1      33 0.00072   24.6   2.4   29   86-120    78-106 (111)
 38 COG5470 Uncharacterized conser  36.9      32 0.00069   25.4   2.3   21   95-118    50-70  (96)
 39 smart00461 WH1 WASP homology r  36.0      31 0.00067   24.8   2.2   17  105-121    86-102 (106)
 40 PF14259 RRM_6:  RNA recognitio  35.7      41 0.00088   20.9   2.5   18  105-122    43-60  (70)
 41 PRK13864 type IV secretion sys  35.7      51  0.0011   27.9   3.7   23  105-127    69-94  (245)
 42 PRK00823 phhB pterin-4-alpha-c  35.6      38 0.00083   23.9   2.6   34   86-121    16-49  (97)
 43 TIGR00746 arcC carbamate kinas  35.3      35 0.00076   29.3   2.7   24  107-130   131-154 (310)
 44 cd01207 Ena-Vasp Enabled-VASP-  35.0      29 0.00064   25.9   1.9   45   71-121    54-103 (111)
 45 smart00156 PP2Ac Protein phosp  34.3      67  0.0014   26.7   4.2   40   83-129   176-218 (271)
 46 PRK08179 prfH peptide chain re  34.0      31 0.00067   28.2   2.1   17  115-131    27-43  (200)
 47 cd00913 PCD_DCoH_subfamily_a P  33.9      54  0.0012   22.1   3.0   29   90-120     1-29  (76)
 48 PRK09437 bcp thioredoxin-depen  33.8      42 0.00091   24.3   2.6   26  105-130    69-94  (154)
 49 PF02786 CPSase_L_D2:  Carbamoy  33.3      44 0.00096   26.8   2.9   21  109-129    25-45  (211)
 50 PF09383 NIL:  NIL domain;  Int  33.0      40 0.00087   22.1   2.2   24  105-128    49-76  (76)
 51 TIGR01465 cobM_cbiF precorrin-  32.7      60  0.0013   25.3   3.5   33   89-129    74-106 (229)
 52 PF00076 RRM_1:  RNA recognitio  32.5      51  0.0011   19.9   2.5   18  105-122    43-61  (70)
 53 cd00837 EVH1 EVH1 (Enabled, Va  32.4      46   0.001   23.7   2.6   16  105-120    84-99  (104)
 54 PLN00200 argininosuccinate syn  32.2      31 0.00068   30.8   2.0   20  107-126   152-171 (404)
 55 COG0007 CysG Uroporphyrinogen-  31.7      62  0.0013   27.3   3.5   28   94-129    89-116 (244)
 56 COG4314 NosL Predicted lipopro  31.2      35 0.00076   27.6   1.9   21  105-125   130-150 (176)
 57 cd00914 PCD_DCoH_subfamily_b P  30.9      52  0.0011   22.2   2.5   29   90-120     1-29  (76)
 58 PRK01792 ribB 3,4-dihydroxy-2-  30.5      42  0.0009   27.8   2.3   18  108-125   182-199 (214)
 59 TIGR00506 ribB 3,4-dihydroxy-2  30.5      46 0.00099   27.1   2.5   18  108-125   172-189 (199)
 60 PF10009 DUF2252:  Uncharacteri  29.4      29 0.00063   30.5   1.3   42   82-123   287-335 (385)
 61 TIGR03072 release_prfH putativ  29.3      41 0.00089   27.4   2.1   17  115-131    26-42  (200)
 62 PF14657 Integrase_AP2:  AP2-li  29.2      45 0.00097   20.4   1.8   13  108-120    24-36  (46)
 63 PF14791 DNA_pol_B_thumb:  DNA   29.0     5.9 0.00013   26.6  -2.4   11   88-98      2-12  (64)
 64 KOG1706 Argininosuccinate synt  29.0      33 0.00071   30.8   1.5   23  107-129   154-176 (412)
 65 PF12123 Amidase02_C:  N-acetyl  28.8      68  0.0015   20.5   2.6   18  110-127    28-45  (45)
 66 KOG0097 GTPase Rab14, small G   28.7      41  0.0009   27.2   1.9   42   85-126    99-151 (215)
 67 COG0216 PrfA Protein chain rel  28.7      44 0.00096   29.9   2.3   18  115-132   139-156 (363)
 68 PF10566 Glyco_hydro_97:  Glyco  28.6      53  0.0011   27.9   2.7   25  105-129    28-52  (273)
 69 PF01329 Pterin_4a:  Pterin 4 a  28.4      53  0.0012   23.0   2.3   31   86-120    15-46  (95)
 70 cd03421 SirA_like_N SirA_like_  28.3      61  0.0013   20.8   2.4   21  110-130    37-57  (67)
 71 cd06576 PASTA_Pbp2x-like_1 PAS  28.0      94   0.002   18.1   3.1   22  109-130     8-29  (55)
 72 PF03795 YCII:  YCII-related do  27.9      41 0.00089   22.6   1.6   17  104-120    61-77  (95)
 73 PTZ00056 glutathione peroxidas  27.9      56  0.0012   25.7   2.6   21  108-128    88-108 (199)
 74 PF11823 DUF3343:  Protein of u  27.7      88  0.0019   20.6   3.2   24  105-128    44-69  (73)
 75 TIGR03798 ocin_TIGR03798 bacte  27.6      28 0.00061   22.8   0.7   22  107-128    23-44  (64)
 76 PF13911 AhpC-TSA_2:  AhpC/TSA   27.4      39 0.00085   23.5   1.5   29  105-133    18-46  (115)
 77 PRK00910 ribB 3,4-dihydroxy-2-  27.0      52  0.0011   27.3   2.3   19  108-126   183-201 (218)
 78 PF00926 DHBP_synthase:  3,4-di  26.9      57  0.0012   26.4   2.5   19  108-126   167-185 (194)
 79 PRK12454 carbamate kinase-like  26.7      55  0.0012   28.4   2.5   22  107-128   134-155 (313)
 80 PRK00014 ribB 3,4-dihydroxy-2-  26.1      55  0.0012   27.4   2.3   18  108-125   187-204 (230)
 81 PF02177 APP_N:  Amyloid A4 N-t  25.9      56  0.0012   24.3   2.1   23  105-127    31-53  (102)
 82 PF12745 HGTP_anticodon2:  Anti  25.8      75  0.0016   26.8   3.1   23  109-131    44-66  (273)
 83 cd01206 Homer Homer type EVH1   25.7      74  0.0016   24.0   2.7   23   96-120    79-102 (111)
 84 cd03017 PRX_BCP Peroxiredoxin   25.4      77  0.0017   22.1   2.7   26  105-130    62-87  (140)
 85 PF09691 PulS_OutS:  Bacterial   25.0      47   0.001   24.7   1.5   14  112-125    53-66  (109)
 86 cd04438 DEP_dishevelled DEP (D  24.7      85  0.0018   22.0   2.7   24  108-131    46-72  (84)
 87 PF08759 DUF1792:  Domain of un  24.6      40 0.00086   28.2   1.2   26   40-65    125-153 (225)
 88 KOG0098 GTPase Rab2, small G p  24.3      58  0.0013   27.2   2.1  103   21-126    21-146 (216)
 89 PF14542 Acetyltransf_CG:  GCN5  24.1      69  0.0015   21.6   2.1   17  111-127    44-60  (78)
 90 PF00764 Arginosuc_synth:  Argi  23.9      42 0.00091   30.0   1.3   18  111-128   147-164 (388)
 91 KOG0081 GTPase Rab27, small G   23.6      60  0.0013   26.8   2.0   21  107-127   140-160 (219)
 92 KOG2741 Dimeric dihydrodiol de  23.3      57  0.0012   29.1   2.0   20  105-124    37-56  (351)
 93 cd04235 AAK_CK AAK_CK: Carbama  23.3      90   0.002   26.9   3.2   23  107-129   130-152 (308)
 94 cd03012 TlpA_like_DipZ_like Tl  23.0      67  0.0015   22.5   2.0   22  109-130    71-92  (126)
 95 KOG0369 Pyruvate carboxylase [  22.8      77  0.0017   31.5   2.9   22  108-129   170-191 (1176)
 96 COG2154 Pterin-4a-carbinolamin  22.6      90   0.002   23.0   2.6   32   85-120    15-48  (101)
 97 COG5079 SAC3 Nuclear protein e  22.5      47   0.001   31.6   1.3   25  105-129   356-380 (646)
 98 KOG1769 Ubiquitin-like protein  22.4      47   0.001   24.6   1.1   12  115-126    48-59  (99)
 99 smart00481 POLIIIAc DNA polyme  22.3 1.2E+02  0.0027   19.1   3.0   24  109-132    15-38  (67)
100 PRK06746 peptide chain release  22.1      65  0.0014   28.2   2.1   16  115-130   113-128 (326)
101 cd07202 cPLA2_Grp-IVC Group IV  22.0      44 0.00096   30.4   1.1   23  108-130   321-343 (430)
102 PF07476 MAAL_C:  Methylasparta  21.8      72  0.0016   27.2   2.2   18  110-127   177-194 (248)
103 PRK00923 sirohydrochlorin coba  21.7 1.2E+02  0.0026   21.6   3.1   25  106-130    43-67  (126)
104 TIGR02540 gpx7 putative glutat  21.6      68  0.0015   23.4   1.8   21  108-128    71-92  (153)
105 TIGR01004 PulS_OutS lipoprotei  21.5      62  0.0013   25.0   1.6   13  113-125    70-82  (128)
106 PRK13010 purU formyltetrahydro  21.4 1.3E+02  0.0028   25.6   3.7   27  105-131   124-150 (289)
107 PF10686 DUF2493:  Protein of u  21.4   1E+02  0.0022   20.8   2.6   19  113-131    48-66  (71)
108 PRK13820 argininosuccinate syn  21.4      70  0.0015   28.5   2.2   19  110-128   148-166 (394)
109 PF04895 DUF651:  Archaeal prot  21.2      66  0.0014   24.0   1.7   17  105-121    67-83  (110)
110 PRK00509 argininosuccinate syn  21.2      67  0.0015   28.7   2.0   21  107-127   148-168 (399)
111 cd07419 MPP_Bsu1_C Arabidopsis  21.1 1.8E+02  0.0038   24.7   4.5   23  107-129   238-260 (311)
112 cd07417 MPP_PP5_C PP5, C-termi  21.0   2E+02  0.0043   24.7   4.8   24  105-129   228-251 (316)
113 PRK12686 carbamate kinase; Rev  20.9      71  0.0015   27.6   2.1   22  107-128   132-153 (312)
114 cd03593 CLECT_NK_receptors_lik  20.7      70  0.0015   21.6   1.7   19  109-127    20-38  (116)
115 PF01910 DUF77:  Domain of unkn  20.5      87  0.0019   22.1   2.1   19  111-129    19-37  (92)
116 PF14555 UBA_4:  UBA-like domai  20.3      99  0.0022   18.5   2.1   17  110-126    14-30  (43)
117 KOG1457 RNA binding protein (c  20.3      53  0.0011   28.2   1.1   68   40-132    37-109 (284)
118 PF00331 Glyco_hydro_10:  Glyco  20.3      66  0.0014   27.2   1.7   22  105-126    55-76  (320)
119 cd00488 PCD_DCoH PCD_DCoH: The  20.2 1.3E+02  0.0028   20.1   2.8   16  105-120    13-28  (75)
120 PLN02626 malate synthase        20.1      44 0.00095   31.4   0.7   47   41-90     80-133 (551)
121 cd00860 ThrRS_anticodon ThrRS   20.1 1.4E+02  0.0031   19.2   3.0   23  108-130    37-59  (91)
122 cd06575 PASTA_Pbp2x-like_2 PAS  20.1 1.5E+02  0.0033   16.9   2.9   21  109-129     8-28  (54)

No 1  
>KOG3389 consensus NADH:ubiquinone oxidoreductase, NDUFS4/18 kDa subunit [Energy production and conversion]
Probab=100.00  E-value=1.4e-48  Score=304.08  Aligned_cols=115  Identities=60%  Similarity=1.063  Sum_probs=108.5

Q ss_pred             ccccccccc-ccc--ccccccccccCCCcccc-cceEEEecCCCCCCCCCCCCCCCcEEEccCCCCccCCCcCccCCCCc
Q 032597           22 FSRAFSADA-LVE--VKPGEIGMVSGIPEEHL-RRRVVIYTPARTATQQGSGKLGRWKINFMSTQKWENPLMGWTSTGDP   97 (137)
Q Consensus        22 ~~r~fs~d~-~~~--~~~~e~~~vSG~P~e~~-~R~vrIY~Pak~amQSG~~~~~~W~LeFe~~~rw~nPLMGWtsS~D~   97 (137)
                      +.|.|+.|+ .|+  .+-+|||-|+|+|+||+ .|+||||.|+|++||||.+|+++|+|||+...+||||||||+|++||
T Consensus        42 la~~~~~Dak~ve~d~kld~i~~v~GvPeeH~~sRkvrIf~PAR~~tQSg~gntkkWkiefd~r~rWENPLMGWtsTaDP  121 (178)
T KOG3389|consen   42 LARPFATDAKVVESDYKLDEIGKVSGVPEEHLDSRKVRIFSPARTATQSGSGNTKKWKIEFDSRLRWENPLMGWTSTADP  121 (178)
T ss_pred             ccccccccceeEeehhhhcccccccCCChHHhcceeEEEecchhhhhhcccCCccceEEEecchhhccCccccccccCCc
Confidence            578999998 444  56678999999999999 69999999999999999999999999999999999999999999999


Q ss_pred             cCccCCceeeeCCHHHHHHHHHHcCCcEEEeCCCCCCCCC
Q 032597           98 YANVGDAGLSFDSKEAAREFAERHGWEYVVRKPHRPLLKV  137 (137)
Q Consensus        98 ~sqv~~~~L~F~SkE~AIayaek~Gw~Y~V~~P~~~~~~~  137 (137)
                      ++|| |+.|.|+|+|||++|||||||+|.|++|+++++||
T Consensus       122 lsNv-gm~L~F~tkEdA~sFaEkngW~ydveep~~pk~K~  160 (178)
T KOG3389|consen  122 LSNV-GMALAFDTKEDAKSFAEKNGWDYDVEEPNTPKLKV  160 (178)
T ss_pred             cccc-ceeeeeccHHHHHHHHHHcCCcccccCCCCCcccc
Confidence            9999 58999999999999999999999999999999875


No 2  
>PF04800 ETC_C1_NDUFA4:  ETC complex I subunit conserved region;  InterPro: IPR006885 This entry represents prokaryotic NADH-ubiquinone oxidoreductase subunits (1.6.5.3 from EC, 1.6.99.3 from EC) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein [].; GO: 0016651 oxidoreductase activity, acting on NADH or NADPH, 0022900 electron transport chain, 0005743 mitochondrial inner membrane; PDB: 2JYA_A 2LJU_A.
Probab=100.00  E-value=1.1e-44  Score=264.81  Aligned_cols=83  Identities=47%  Similarity=0.963  Sum_probs=60.8

Q ss_pred             ceEEEecCCCCCCCCCCCCCCCcEEEccCCCCccCCCcCccCCCCccCc-cCCceeeeCCHHHHHHHHHHcCCcEEEeCC
Q 032597           52 RRVVIYTPARTATQQGSGKLGRWKINFMSTQKWENPLMGWTSTGDPYAN-VGDAGLSFDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus        52 R~vrIY~Pak~amQSG~~~~~~W~LeFe~~~rw~nPLMGWtsS~D~~sq-v~~~~L~F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      |+||||+|+|+|||||.+++++|+|||+..++|+|||||||||+||++| |   +|+|+|+||||+|||+|||+|+|++|
T Consensus         1 r~arIy~pak~amQSG~~~t~~W~lefe~~~~~~~PLMGWtss~D~~~q~v---~l~F~skE~Ai~yaer~G~~Y~V~~p   77 (101)
T PF04800_consen    1 RKARIYQPAKNAMQSGTANTKKWVLEFETRARWENPLMGWTSSGDPLSQSV---RLKFDSKEDAIAYAERNGWDYEVEEP   77 (101)
T ss_dssp             -EEEEE--SS--STTTT-SS--EEEEEEESSS---TTT-SSSS--SEEE-C---EEEESSHHHHHHHHHHCT-EEEEE-S
T ss_pred             CeEEEeCCCCCCCCCCCCCCCCEEEeecCcCCcCCCccCCCCCCChhhCee---EeeeCCHHHHHHHHHHcCCeEEEeCC
Confidence            6899999999999999999999999999889999999999999999998 8   99999999999999999999999999


Q ss_pred             CCCCCCC
Q 032597          131 HRPLLKV  137 (137)
Q Consensus       131 ~~~~~~~  137 (137)
                      +.+++++
T Consensus        78 ~~r~~~~   84 (101)
T PF04800_consen   78 KKRKRRP   84 (101)
T ss_dssp             TT-----
T ss_pred             CCCcCCc
Confidence            9988754


No 3  
>PF09954 DUF2188:  Uncharacterized protein conserved in bacteria (DUF2188);  InterPro: IPR018691  This family has no known function. 
Probab=86.41  E-value=0.53  Score=30.66  Aligned_cols=25  Identities=32%  Similarity=0.452  Sum_probs=18.0

Q ss_pred             eeeeCCHHHHHHHHHH----c-CCcEEEeC
Q 032597          105 GLSFDSKEAAREFAER----H-GWEYVVRK  129 (137)
Q Consensus       105 ~L~F~SkE~AIayaek----~-Gw~Y~V~~  129 (137)
                      ...|+|+++||++|++    + +-+..|..
T Consensus        22 ~~~~~Tk~eAi~~Ar~~a~~~~~~el~Ih~   51 (62)
T PF09954_consen   22 SKTFDTKAEAIEAARELAKNQGGGELIIHG   51 (62)
T ss_pred             ccccCcHHHHHHHHHHHHHhCCCcEEEEEC
Confidence            5689999999998764    3 55555544


No 4  
>PF08727 P3A:  Poliovirus 3A protein like;  InterPro: IPR014838 The 3A protein is found in positive-strand RNA viruses. It is a critical component of the poliovirus replication complex, and is also an inhibitor of host cell ER to Golgi transport. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0017111 nucleoside-triphosphatase activity; PDB: 1NG7_A.
Probab=80.60  E-value=1.1  Score=30.28  Aligned_cols=16  Identities=31%  Similarity=0.717  Sum_probs=11.0

Q ss_pred             HHHHHHHHHcCCcEEE
Q 032597          112 EAAREFAERHGWEYVV  127 (137)
Q Consensus       112 E~AIayaek~Gw~Y~V  127 (137)
                      ++-++|||++||-...
T Consensus        30 ~eV~~YC~~~GWIip~   45 (57)
T PF08727_consen   30 PEVREYCEEQGWIIPA   45 (57)
T ss_dssp             HHHHHHHHHHT--TT-
T ss_pred             HHHHHHHHHCCccccC
Confidence            5689999999996554


No 5  
>PHA02552 4 head completion protein; Provisional
Probab=80.32  E-value=1.6  Score=34.26  Aligned_cols=70  Identities=19%  Similarity=0.291  Sum_probs=42.9

Q ss_pred             ceEEEecCCCCC-CCCCCCCCCCcEEEccCCCCccCCCcCccCCCCccCccCCceeee-----------CCHHHHHHHHH
Q 032597           52 RRVVIYTPARTA-TQQGSGKLGRWKINFMSTQKWENPLMGWTSTGDPYANVGDAGLSF-----------DSKEAAREFAE  119 (137)
Q Consensus        52 R~vrIY~Pak~a-mQSG~~~~~~W~LeFe~~~rw~nPLMGWtsS~D~~sqv~~~~L~F-----------~SkE~AIayae  119 (137)
                      -++|.|-|+=-+ +.+|    ....+|.-+..+..+|.+-  ..-|+.+     ...|           +--++|.+||+
T Consensus        60 Gk~r~Y~PDFLV~~~dG----~~~lvEVKp~~~~~~p~~~--~~~~~~~-----~~~~~~~~~~w~~~~~K~~Aa~~~a~  128 (151)
T PHA02552         60 GKRRRYFMDFYVKVDNG----QKFLIEVKPKKETQPPKKP--AKMTTAA-----KKRFINEVYTWSVNTDKWKAARALCE  128 (151)
T ss_pred             CCeeeEcCcEEEEEeCC----CEEEEEEccHHHccCcccc--cccchhh-----hhhhhhhhhhHHHHHHHHHHHHHHHH
Confidence            567788887433 2233    4778888887776666442  1111110     1122           12378999999


Q ss_pred             HcCCcEEEeCCCC
Q 032597          120 RHGWEYVVRKPHR  132 (137)
Q Consensus       120 k~Gw~Y~V~~P~~  132 (137)
                      ++||.|.|.....
T Consensus       129 ~~Gw~F~iiTE~~  141 (151)
T PHA02552        129 KKGWKFKIITEDE  141 (151)
T ss_pred             HcCCEEEEEEHHH
Confidence            9999999976543


No 6  
>PF05573 NosL:  NosL;  InterPro: IPR008719 NosL is one of the accessory proteins of the nos (nitrous oxide reductase) gene cluster. NosL is a monomeric protein of 18,540 MW that specifically and stoichiometrically binds Cu(I). The copper ion in NosL is ligated by a Cys residue, and one Met and one His are thought to serve as the other ligands. It is possible that NosL is a copper chaperone involved in metallocentre assembly []. This entry also contains HTH-type transcriptional repressors, including YcnK. YcnK may act as a negative transcriptional regulator of YcnJ in the presence of copper and may use copper as a corepressor. The gene, ycnK, is significantly induced under copper-limiting conditions.; PDB: 2HQ3_A 2HPU_A.
Probab=78.36  E-value=2.9  Score=31.75  Aligned_cols=50  Identities=28%  Similarity=0.595  Sum_probs=27.4

Q ss_pred             CCcEEEccCCCCccCCCc-CccCC--------CCccCccCCceeeeCCHHHHHHHHHHcC
Q 032597           72 GRWKINFMSTQKWENPLM-GWTST--------GDPYANVGDAGLSFDSKEAAREFAERHG  122 (137)
Q Consensus        72 ~~W~LeFe~~~rw~nPLM-GWtsS--------~D~~sqv~~~~L~F~SkE~AIayaek~G  122 (137)
                      ..|+-||.. ..|.+|-- -|...        +|-.+-.+...+-|.++|+|.+|+++||
T Consensus        77 ~~~V~D~~~-~~~~~p~~~~~Ida~~A~yV~gs~~~~pMg~~~~aF~~~~~A~~F~~~~G  135 (149)
T PF05573_consen   77 AIYVTDYST-TDWDQPGDGEWIDAKKAYYVVGSDVRGPMGPDLIAFASKEDAEAFAKEHG  135 (149)
T ss_dssp             EEEEEES-T-S-TT-S---EEEEGGGSEEEEESSSS-TTS--EEEES-HHHHHHHHHHTE
T ss_pred             EEEEEeccc-ccccCCCCCceEEcceEEEEECCCcCCCCCCcccccCCHHHHHHHHHHcC
Confidence            568888877 45555542 33332        1211112223678999999999999998


No 7  
>PRK05370 argininosuccinate synthase; Validated
Probab=75.58  E-value=2  Score=39.09  Aligned_cols=23  Identities=22%  Similarity=0.479  Sum_probs=20.1

Q ss_pred             eeeCCHHHHHHHHHHcCCcEEEe
Q 032597          106 LSFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       106 L~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      -.|.|+++.|+||++||++..+.
T Consensus       164 ~~f~sR~e~i~Ya~~hGIpv~~~  186 (447)
T PRK05370        164 DELGGRAEMSEFLIAHGFDYKMS  186 (447)
T ss_pred             cccCCHHHHHHHHHHcCCCCCcc
Confidence            36899999999999999997653


No 8  
>PF08722 Tn7_Tnp_TnsA_N:  TnsA endonuclease N terminal;  InterPro: IPR014833 The Tn7 transposase is composed of proteins TnsA and TnsB. DNA breakage at the 5'-end of the transposon is carried out by TnsA, and breakage and joining at the 3'-end is carried out by TnsB. The N-terminal domain of TnsA is catalytic. ; PDB: 1F1Z_B 1T0F_B.
Probab=70.07  E-value=4.7  Score=27.52  Aligned_cols=19  Identities=26%  Similarity=0.427  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHcCCcEEEeC
Q 032597          111 KEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       111 kE~AIayaek~Gw~Y~V~~  129 (137)
                      .+.|-.||+++||+|.|..
T Consensus        69 ~~~~~~y~~~~g~~f~ivT   87 (88)
T PF08722_consen   69 LEIEREYWEEQGIPFRIVT   87 (88)
T ss_dssp             HHHHHHHHHHCT--EEEE-
T ss_pred             HHHHHHHHHHcCCeEEEEc
Confidence            3568899999999999863


No 9  
>PF11360 DUF3110:  Protein of unknown function (DUF3110);  InterPro: IPR021503  This family of proteins has no known function. 
Probab=68.23  E-value=8  Score=27.51  Aligned_cols=25  Identities=28%  Similarity=0.441  Sum_probs=19.9

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEeCCC
Q 032597          107 SFDSKEAAREFAERHGWEYVVRKPH  131 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~~P~  131 (137)
                      .-=..++-+.||+++|+.|+|..+.
T Consensus        53 e~id~~~i~~fC~~~gy~~~iv~~g   77 (86)
T PF11360_consen   53 EEIDPEEIEEFCRSAGYEYEIVPPG   77 (86)
T ss_pred             EEECHHHHHHHHHHCCceEEEECCC
Confidence            3445666778899999999999887


No 10 
>PF03462 PCRF:  PCRF domain;  InterPro: IPR005139 This domain is found in peptide chain release factors. Peptide chain release factors are important for protein synthesis since they direct the termination of translation in response to the peptide chain termination codons UAG and UAA. These are structurally distinct but both contain the PCRF domain [].; GO: 0016149 translation release factor activity, codon specific, 0006415 translational termination, 0005737 cytoplasm; PDB: 3D5A_X 3D5C_X 3MR8_V 3MS0_V 3F1G_X 3F1E_X 1ZBT_A 2IHR_1 2X9R_Y 2X9T_Y ....
Probab=62.84  E-value=5.5  Score=29.13  Aligned_cols=15  Identities=40%  Similarity=0.866  Sum_probs=12.3

Q ss_pred             HHHHHHcCCcEEEeC
Q 032597          115 REFAERHGWEYVVRK  129 (137)
Q Consensus       115 Iayaek~Gw~Y~V~~  129 (137)
                      ..||+++||+|+|..
T Consensus        73 ~~~a~~~gw~~~~l~   87 (115)
T PF03462_consen   73 QRYAERRGWKVEVLD   87 (115)
T ss_dssp             HHHHHHTT-EEEEEE
T ss_pred             HHHHHHcCCEEEEEe
Confidence            489999999999975


No 11 
>PF11360 DUF3110:  Protein of unknown function (DUF3110);  InterPro: IPR021503  This family of proteins has no known function. 
Probab=59.22  E-value=8.5  Score=27.38  Aligned_cols=19  Identities=32%  Similarity=0.482  Sum_probs=16.3

Q ss_pred             CccCCceeeeCCHHHHHHHHHH
Q 032597           99 ANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        99 sqv~~~~L~F~SkE~AIayaek  120 (137)
                      .++   .|-|.+.+||..||.-
T Consensus        23 ~~~---Vl~FE~edDA~RYa~l   41 (86)
T PF11360_consen   23 RNV---VLMFEDEDDAERYAGL   41 (86)
T ss_pred             CCE---EEEEccHHHHHHHHHH
Confidence            555   8999999999999964


No 12 
>PF08803 ydhR:  Putative mono-oxygenase ydhR;  InterPro: IPR014910 YdhR is a homodimeric protein that comprises of a central four-stranded beta sheet and four surrounding alpha helices []. It shows structural homology to the ActVA-Orf6 and YgiN proteins which indicates it could be a mono-oxygenase. ; PDB: 1WD6_B 2HIQ_B 2ASY_B.
Probab=56.98  E-value=7.4  Score=28.62  Aligned_cols=29  Identities=24%  Similarity=0.492  Sum_probs=22.9

Q ss_pred             ccCCCCccCccCCceeeeCCHHHHHHHHHHc
Q 032597           91 WTSTGDPYANVGDAGLSFDSKEAAREFAERH  121 (137)
Q Consensus        91 WtsS~D~~sqv~~~~L~F~SkE~AIayaek~  121 (137)
                      ||.+.++.. .+| ..-|+|+++|.+|+++|
T Consensus        38 Wten~~t~e-aGG-iYLFe~e~~A~aY~~~h   66 (97)
T PF08803_consen   38 WTENEETGE-AGG-IYLFEDEASAEAYLEMH   66 (97)
T ss_dssp             EEEETTTTE-EEE-EEEESSHHHHHHHHHHH
T ss_pred             EEecCCCCc-cce-EEEECCHHHHHHHHHHH
Confidence            888777753 333 57799999999999987


No 13 
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=56.11  E-value=11  Score=24.51  Aligned_cols=14  Identities=36%  Similarity=0.432  Sum_probs=12.8

Q ss_pred             eeeeCCHHHHHHHH
Q 032597          105 GLSFDSKEAAREFA  118 (137)
Q Consensus       105 ~L~F~SkE~AIaya  118 (137)
                      .+.|+|.++|.+|-
T Consensus        43 iieFPs~~aa~~~~   56 (65)
T PF07045_consen   43 IIEFPSMEAAKAWY   56 (65)
T ss_dssp             EEEESSHHHHHHHH
T ss_pred             EEECCCHHHHHHHH
Confidence            89999999999874


No 14 
>PF06194 Phage_Orf51:  Phage Conserved Open Reading Frame 51;  InterPro: IPR009338 This entry is represented by the Staphylococcus phage PVL (bacteriophage phi-PVL), Orf51. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=54.91  E-value=10  Score=27.11  Aligned_cols=23  Identities=17%  Similarity=0.354  Sum_probs=21.4

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEE
Q 032597          105 GLSFDSKEAAREFAERHGWEYVV  127 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V  127 (137)
                      ...|+|+++=..|-+.+|+.||=
T Consensus        51 KktFn~~~Ef~~Yi~~~~L~~ee   73 (80)
T PF06194_consen   51 KKTFNNKEEFENYIKQHELYFEE   73 (80)
T ss_pred             hhhcCcHHHHHHHHHHcCCceeh
Confidence            88999999999999999999874


No 15 
>KOG2854 consensus Possible pfkB family carbohydrate kinase [Carbohydrate transport and metabolism]
Probab=54.88  E-value=10  Score=33.51  Aligned_cols=21  Identities=38%  Similarity=0.833  Sum_probs=19.3

Q ss_pred             eeeeCCHHHHHHHHHHcCCcE
Q 032597          105 GLSFDSKEAAREFAERHGWEY  125 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y  125 (137)
                      -+-|.+.+||.+||+-+||+-
T Consensus       216 DiifgNe~EA~af~~~~~~~t  236 (343)
T KOG2854|consen  216 DIIFGNEDEAAAFARAHGWET  236 (343)
T ss_pred             eEEEcCHHHHHHHHHhhCCcc
Confidence            678999999999999999974


No 16 
>PRK04527 argininosuccinate synthase; Provisional
Probab=54.55  E-value=8.6  Score=34.36  Aligned_cols=22  Identities=9%  Similarity=0.317  Sum_probs=18.7

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      +++++++.|+||++||++..+.
T Consensus       150 k~~~R~~~i~ya~~~gipv~~~  171 (400)
T PRK04527        150 HTQTRAYEQKYLEERGFGVRAK  171 (400)
T ss_pred             ccccHHHHHHHHHHcCCCCCCC
Confidence            4579999999999999987653


No 17 
>PF10075 PCI_Csn8:  COP9 signalosome, subunit CSN8;  InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8. In the complex, Cops8, which is the smallest subunit, probably interacts directly with Cops3, Cops4 and Cops7 (Cops7A or Cops7B). This signalosome is homologous to the lid subcomplex of the 26S proteasome and regulates the ubiquitin-proteasome pathway. It functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development [].; PDB: 1RZ4_A.
Probab=54.45  E-value=7.1  Score=28.85  Aligned_cols=20  Identities=25%  Similarity=0.611  Sum_probs=15.2

Q ss_pred             eeeCCHHHHHHHHHHcCCcEE
Q 032597          106 LSFDSKEAAREFAERHGWEYV  126 (137)
Q Consensus       106 L~F~SkE~AIayaek~Gw~Y~  126 (137)
                      |.|+ .+++++||+++||.++
T Consensus       107 Lg~~-~~el~~~~~~~gW~~d  126 (143)
T PF10075_consen  107 LGLS-EEELEKFIKSRGWTVD  126 (143)
T ss_dssp             TTS--HHHHHHHHHHHT-EE-
T ss_pred             hCCC-HHHHHHHHHHcCCEEC
Confidence            5566 8999999999999986


No 18 
>PF13031 DUF3892:  Protein of unknown function (DUF3892)
Probab=54.13  E-value=12  Score=25.77  Aligned_cols=23  Identities=26%  Similarity=0.338  Sum_probs=19.8

Q ss_pred             eeeCCHHHHHHHHHHcCCcEEEe
Q 032597          106 LSFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       106 L~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      +-.-|+++||+++|+..|.|.|.
T Consensus        28 ~~~~s~~~~i~~ie~g~~~~yv~   50 (85)
T PF13031_consen   28 PWKYSREEAIAWIENGKWSFYVE   50 (85)
T ss_pred             cccccHHHHHHHHHcCCceEEeC
Confidence            34558999999999998999988


No 19 
>KOG4748 consensus Subunit of Golgi mannosyltransferase complex [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis]
Probab=51.21  E-value=11  Score=33.64  Aligned_cols=23  Identities=26%  Similarity=0.537  Sum_probs=19.3

Q ss_pred             CHHHHHHHHHHcCCcEEEeCCCC
Q 032597          110 SKEAAREFAERHGWEYVVRKPHR  132 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~V~~P~~  132 (137)
                      +-+.=|+||++||+++++..-..
T Consensus       127 ~ikNridYA~rHgy~~~~~~~~~  149 (364)
T KOG4748|consen  127 SIKNRIDYARRHGYEFEYKNATL  149 (364)
T ss_pred             HHHhHHHHHHHhCCeEEEEeccc
Confidence            77788999999999999876543


No 20 
>PF01071 GARS_A:  Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;  InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ....
Probab=50.78  E-value=17  Score=29.33  Aligned_cols=25  Identities=40%  Similarity=0.539  Sum_probs=21.2

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .-.|.+.++|++|.++++..+.|..
T Consensus        20 ~~~f~~~~~A~~~l~~~~~p~~ViK   44 (194)
T PF01071_consen   20 YKVFTDYEEALEYLEEQGYPYVVIK   44 (194)
T ss_dssp             EEEESSHHHHHHHHHHHSSSEEEEE
T ss_pred             eeEECCHHHHHHHHHhcCCCceEEc
Confidence            3579999999999999999994443


No 21 
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=49.79  E-value=20  Score=23.20  Aligned_cols=29  Identities=41%  Similarity=0.757  Sum_probs=23.4

Q ss_pred             eeeeCCHHHH----HHHHHHcCCcEEEeCCCCC
Q 032597          105 GLSFDSKEAA----REFAERHGWEYVVRKPHRP  133 (137)
Q Consensus       105 ~L~F~SkE~A----Iayaek~Gw~Y~V~~P~~~  133 (137)
                      .+.|+|+++.    ..||-+++.+|.|..-...
T Consensus         7 G~~F~~~~e~k~av~~yai~~~~~~~v~ksd~~   39 (67)
T PF03108_consen    7 GQTFPSKEEFKEAVREYAIKNGFEFKVKKSDKK   39 (67)
T ss_pred             CCEECCHHHHHHHHHHHHHhcCcEEEEeccCCE
Confidence            6899999876    4699999999999765543


No 22 
>COG3341 Predicted double-stranded RNA/RNA-DNA hybrid binding protein [General function prediction only]
Probab=49.25  E-value=11  Score=31.54  Aligned_cols=14  Identities=43%  Similarity=0.582  Sum_probs=12.9

Q ss_pred             eeCCHHHHHHHHHH
Q 032597          107 SFDSKEAAREFAER  120 (137)
Q Consensus       107 ~F~SkE~AIayaek  120 (137)
                      +|+|.|+|.+||+-
T Consensus        39 sf~s~EeA~a~~~g   52 (225)
T COG3341          39 SFKSYEEAEAYCEG   52 (225)
T ss_pred             ccccHHHHHHHhcc
Confidence            59999999999994


No 23 
>PF12518 DUF3721:  Protein of unknown function;  InterPro: IPR022196  This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. There is a conserved WMPC sequence motif. There are two completely conserved residues (A and C) that may be functionally important. 
Probab=48.89  E-value=16  Score=22.22  Aligned_cols=16  Identities=25%  Similarity=0.368  Sum_probs=14.1

Q ss_pred             eCCHHHHHHHHHHcCC
Q 032597          108 FDSKEAAREFAERHGW  123 (137)
Q Consensus       108 F~SkE~AIayaek~Gw  123 (137)
                      |+|+++|.+=|.+.|-
T Consensus         1 y~tk~eAe~~A~~~GC   16 (34)
T PF12518_consen    1 YPTKAEAEKRAKELGC   16 (34)
T ss_pred             CCcHHHHHHHHHHcCC
Confidence            8999999999998774


No 24 
>PF07862 Nif11:  Nitrogen fixation protein of unknown function;  InterPro: IPR012903 This domain is found in the cyanobacteria, and the nitrogen-fixing proteobacterium Azotobacter vinelandii and may be involved in nitrogen fixation, but no role has been assigned []. 
Probab=47.26  E-value=9.7  Score=23.52  Aligned_cols=21  Identities=14%  Similarity=0.374  Sum_probs=18.0

Q ss_pred             eCCHHHHHHHHHHcCCcEEEe
Q 032597          108 FDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      ..+.|+-|++|+.+|+.+...
T Consensus        26 ~~~~~e~~~lA~~~Gy~ft~~   46 (49)
T PF07862_consen   26 CQNPEEVVALAREAGYDFTEE   46 (49)
T ss_pred             cCCHHHHHHHHHHcCCCCCHH
Confidence            459999999999999998643


No 25 
>PF01693 Cauli_VI:  Caulimovirus viroplasmin;  InterPro: IPR011320 This entry represents the N-terminal domain of RNase HI, which has a 3-layer alpha/beta/alpha structure []. This domain is lacking in retroviral and prokaryotic enzymes, but shows a striking structural similarity to the ribosomal protein L9 N-terminal domain, and may function as a regulatory RNA-binding module. However, the topology of this domain differs from structures of known RNA binding domains such as the double-stranded RNA binding domain (dsRBD), the hnRNP K homology (KH) domain and the RNP motif. Eukaryotic RNases HI possess either one or two copies of this small N-terminal domain, in addition to the well-conserved catalytic RNase H domain. RNase HI belongs to the family of ribonuclease H enzymes that recognise RNA:DNA hybrids and degrade the RNA component. ; PDB: 1QHK_A 3BSU_C.
Probab=46.38  E-value=21  Score=21.80  Aligned_cols=13  Identities=46%  Similarity=0.636  Sum_probs=11.7

Q ss_pred             eeeeCCHHHHHHH
Q 032597          105 GLSFDSKEAAREF  117 (137)
Q Consensus       105 ~L~F~SkE~AIay  117 (137)
                      ..+|+|+|+|.+|
T Consensus        32 ~k~F~t~~eA~~~   44 (44)
T PF01693_consen   32 YKSFKTREEAEEF   44 (44)
T ss_dssp             EEEESSHHHHHHH
T ss_pred             ECCcCCHHHHhhC
Confidence            6789999999987


No 26 
>PRK11118 putative monooxygenase; Provisional
Probab=45.39  E-value=28  Score=25.90  Aligned_cols=29  Identities=24%  Similarity=0.497  Sum_probs=22.6

Q ss_pred             ccCCCCccCccCCceeeeCCHHHHHHHHHHc
Q 032597           91 WTSTGDPYANVGDAGLSFDSKEAAREFAERH  121 (137)
Q Consensus        91 WtsS~D~~sqv~~~~L~F~SkE~AIayaek~  121 (137)
                      ||.+.++.. .+ -..-|+++++|-+|.++|
T Consensus        41 WTen~~t~e-aG-GiYlF~~e~~a~aYl~mH   69 (100)
T PRK11118         41 WTENEKTQE-AG-GIYLFEDEASAEAYLEMH   69 (100)
T ss_pred             eecCCCCcc-cc-eEEEECCHHHHHHHHHHH
Confidence            777777753 23 367899999999999876


No 27 
>PRK05773 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated
Probab=44.45  E-value=18  Score=29.90  Aligned_cols=17  Identities=35%  Similarity=0.464  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHcCCcE
Q 032597          109 DSKEAAREFAERHGWEY  125 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y  125 (137)
                      -++++|++||++||+++
T Consensus       191 ~~~~~~~~fA~~~~l~~  207 (219)
T PRK05773        191 LSKEKAKKIAKNLGFPL  207 (219)
T ss_pred             cCHHHHHHHHHHcCCcE
Confidence            37999999999999998


No 28 
>COG0108 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism]
Probab=44.33  E-value=18  Score=29.90  Aligned_cols=18  Identities=28%  Similarity=0.447  Sum_probs=15.8

Q ss_pred             CCHHHHHHHHHHcCCcEE
Q 032597          109 DSKEAAREFAERHGWEYV  126 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~  126 (137)
                      ..++++++||++||+++.
T Consensus       172 ar~~~~~~fa~~h~l~~i  189 (203)
T COG0108         172 ARLPELEEFAKEHGLPVI  189 (203)
T ss_pred             cChHHHHHHHHHcCCcEE
Confidence            467999999999999875


No 29 
>PF02844 GARS_N:  Phosphoribosylglycinamide synthetase, N domain;  InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ....
Probab=43.17  E-value=24  Score=25.75  Aligned_cols=28  Identities=21%  Similarity=0.361  Sum_probs=22.5

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeCCCC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRKPHR  132 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~P~~  132 (137)
                      .+...+.++-++||+++++++.|.-|..
T Consensus        45 ~~~~~d~~~l~~~a~~~~idlvvvGPE~   72 (100)
T PF02844_consen   45 PIDITDPEELADFAKENKIDLVVVGPEA   72 (100)
T ss_dssp             -S-TT-HHHHHHHHHHTTESEEEESSHH
T ss_pred             CCCCCCHHHHHHHHHHcCCCEEEECChH
Confidence            4467889999999999999999998854


No 30 
>PLN00139 hypothetical protein; Provisional
Probab=42.53  E-value=22  Score=30.42  Aligned_cols=26  Identities=15%  Similarity=0.054  Sum_probs=21.4

Q ss_pred             eeeCCHHHHHHHHHHcCCcEEEeCCC
Q 032597          106 LSFDSKEAAREFAERHGWEYVVRKPH  131 (137)
Q Consensus       106 L~F~SkE~AIayaek~Gw~Y~V~~P~  131 (137)
                      ..-++++++.+||.++|++|+-.+..
T Consensus       195 F~t~d~~eve~~~~~~g~~~eW~~dg  220 (320)
T PLN00139        195 FGTSDKAEAERRAKALGMDMEWLPNG  220 (320)
T ss_pred             hCCCCHHHHHHHHHHcCCeEEEcCCC
Confidence            34578999999999999999976543


No 31 
>PRK12354 carbamate kinase; Reviewed
Probab=41.50  E-value=21  Score=30.87  Aligned_cols=22  Identities=18%  Similarity=0.368  Sum_probs=19.7

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      .|-|+|+|.+.++++||.+...
T Consensus       125 ~~y~~~~a~~~~~e~g~~~~~d  146 (307)
T PRK12354        125 PVYDEAEAERLAAEKGWTIKPD  146 (307)
T ss_pred             cccCHHHHHHHHHhcCCEEeec
Confidence            5999999999999999977665


No 32 
>PF03793 PASTA:  PASTA domain;  InterPro: IPR005543 The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBP) and bacterial serine/threonine kinases. It binds the beta-lactam stem, which implicates it in sensing D-alanyl-D-alanine - the PBP transpeptidase substrate. In PknB of Mycobacterium tuberculosis (P71584 from SWISSPROT), all of the extracellular portion is predicted to be made up of four PASTA domains, which strongly suggests that it is a signal-binding sensor domain. The domain has also been found in proteins involved in cell wall biosynthesis, where it is implicated in localizing the biosynthesis complex to unlinked peptidoglycan. PASTA is a small globular fold consisting of 3 beta-sheets and an alpha-helix, with a loop region of variable length between the first and second beta-strands. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain [].; GO: 0008658 penicillin binding; PDB: 2ZC3_C 1QME_A 1RP5_B 2Z2M_C 2Z2L_F 2ZC4_C 1QMF_A 3M9G_A 3PY9_A 1K25_B ....
Probab=39.84  E-value=32  Score=21.57  Aligned_cols=22  Identities=18%  Similarity=0.169  Sum_probs=17.5

Q ss_pred             CCHHHHHHHHHHcCCcEEEeCC
Q 032597          109 DSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      -|.++|.+..+++||.+.+...
T Consensus         9 ~~~~~a~~~l~~~g~~~~~~~~   30 (63)
T PF03793_consen    9 MTYDEAKSILEAAGLTVNVVEE   30 (63)
T ss_dssp             SBHHHHHHHHHHTT-EEEEEEE
T ss_pred             CcHHHHHHHHHHCCCEEEEEEE
Confidence            4789999999999998777653


No 33 
>PF03682 UPF0158:  Uncharacterised protein family (UPF0158);  InterPro: IPR005361 This is a small family of hypothetical bacterial proteins of unknown function.
Probab=39.33  E-value=23  Score=27.61  Aligned_cols=20  Identities=35%  Similarity=0.444  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHcCCcEEEeCC
Q 032597          111 KEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       111 kE~AIayaek~Gw~Y~V~~P  130 (137)
                      ++.|+++|+.||+.|...++
T Consensus       127 r~~a~eWleen~I~~~~~~~  146 (163)
T PF03682_consen  127 RERAIEWLEENGIEPVFEED  146 (163)
T ss_pred             HHHHHHHHHHcCCCcccccc
Confidence            67899999999999988775


No 34 
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=38.77  E-value=23  Score=32.00  Aligned_cols=21  Identities=29%  Similarity=0.466  Sum_probs=18.9

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      .|. +|+.|+||+++|+++.+.
T Consensus       151 ~~~-R~~~i~Ya~~~gipv~~~  171 (403)
T COG0137         151 NLT-REEEIEYAEEHGIPVKAT  171 (403)
T ss_pred             ccC-hHHHHHHHHHcCCCcccc
Confidence            456 999999999999999887


No 35 
>PF05637 Glyco_transf_34:  galactosyl transferase GMA12/MNN10 family;  InterPro: IPR008630 This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of Caenorhabditis elegans homologues where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.; GO: 0016758 transferase activity, transferring hexosyl groups, 0016021 integral to membrane; PDB: 2P72_B 2P73_A 2P6W_A.
Probab=38.56  E-value=20  Score=29.22  Aligned_cols=17  Identities=29%  Similarity=0.706  Sum_probs=12.1

Q ss_pred             HHHHHHHHHcCCcEEEe
Q 032597          112 EAAREFAERHGWEYVVR  128 (137)
Q Consensus       112 E~AIayaek~Gw~Y~V~  128 (137)
                      +-=+.||++||++|.+.
T Consensus        31 ~Nr~~Ya~~HgY~~~~~   47 (239)
T PF05637_consen   31 QNRVDYARRHGYDLYYR   47 (239)
T ss_dssp             --HHHHHHHHT-EEEEE
T ss_pred             HHHHHHHHhcCCEEEEE
Confidence            33468999999999984


No 36 
>PF05406 WGR:  WGR domain;  InterPro: IPR008893 This domain is named after the most conserved central motif of the domain. It is found in a variety of polyA polymerases as well as the Escherichia coli molybdate metabolism regulator P33345 from SWISSPROT and other proteins of unknown function.The domain is found in isolation in proteins such as Q9JN21 from SWISSPROT and is between 70 and 80 residues in length. ; PDB: 2EOC_A 2RA8_A 4DQY_C 2CR9_A.
Probab=37.11  E-value=29  Score=23.39  Aligned_cols=45  Identities=20%  Similarity=0.229  Sum_probs=25.4

Q ss_pred             CCCcEEEccCCCCcc-CCCcCccCCCCccCccCCceeeeCCHHHHHHHHHH
Q 032597           71 LGRWKINFMSTQKWE-NPLMGWTSTGDPYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        71 ~~~W~LeFe~~~rw~-nPLMGWtsS~D~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      .+.|.|+..+...|. --==|-.++. ...+    .-.|+|.|+|+++.++
T Consensus        19 ~kfY~iql~~~~~~~v~~~wGRiG~~-gq~~----~~~f~s~~eA~~~f~~   64 (81)
T PF05406_consen   19 NKFYRIQLLPDLEWVVFRRWGRIGSK-GQTR----IKPFDSEEEAIKEFEK   64 (81)
T ss_dssp             EEEEEEEEEEETTEEEEEEEEETTSS-EEEE----EEEESSHHHHHHHHHH
T ss_pred             EEEEEEEEEeCCCeEEEEEECCCCCc-CcEE----EEeCCCHHHHHHHHHH
Confidence            456777776432110 0111334444 3333    4589999999998765


No 37 
>PF00568 WH1:  WH1 domain;  InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][].  WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,].  Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=37.07  E-value=33  Score=24.57  Aligned_cols=29  Identities=24%  Similarity=0.359  Sum_probs=20.7

Q ss_pred             CCCcCccCCCCccCccCCceeeeCCHHHHHHHHHH
Q 032597           86 NPLMGWTSTGDPYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        86 nPLMGWtsS~D~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      +-+.-|.+.   ...+   .|.|.|.+||-.|+++
T Consensus        78 ~~Fh~f~~~---~~~~---GLnF~se~eA~~F~~~  106 (111)
T PF00568_consen   78 PFFHQFEDD---DCVY---GLNFASEEEADQFYKK  106 (111)
T ss_dssp             SSEEEEEET---TCEE---EEEESSHHHHHHHHHH
T ss_pred             CcEEEEEeC---CeEE---EEecCCHHHHHHHHHH
Confidence            344555543   2255   8999999999999985


No 38 
>COG5470 Uncharacterized conserved protein [Function unknown]
Probab=36.90  E-value=32  Score=25.42  Aligned_cols=21  Identities=43%  Similarity=0.428  Sum_probs=16.9

Q ss_pred             CCccCccCCceeeeCCHHHHHHHH
Q 032597           95 GDPYANVGDAGLSFDSKEAAREFA  118 (137)
Q Consensus        95 ~D~~sqv~~~~L~F~SkE~AIaya  118 (137)
                      .||-.+|   .+.|+|+|.|.++=
T Consensus        50 w~ptr~v---viEFps~~~ar~~y   70 (96)
T COG5470          50 WRPTRNV---VIEFPSLEAARDCY   70 (96)
T ss_pred             CCcccEE---EEEcCCHHHHHHHh
Confidence            4666677   89999999998763


No 39 
>smart00461 WH1 WASP homology region 1. Region of the Wiskott-Aldrich syndrome protein (WASp) that contains point mutations in the majority of patients with WAS. Unknown function. Ena-like WH1 domains bind polyproline-containing peptides, and that Homer contains a WH1 domain.
Probab=36.00  E-value=31  Score=24.78  Aligned_cols=17  Identities=41%  Similarity=0.780  Sum_probs=15.4

Q ss_pred             eeeeCCHHHHHHHHHHc
Q 032597          105 GLSFDSKEAAREFAERH  121 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~  121 (137)
                      -|.|.|.+||-+|.++.
T Consensus        86 GLnF~se~EA~~F~~~v  102 (106)
T smart00461       86 GLNFASEEEAKKFRKKV  102 (106)
T ss_pred             EeecCCHHHHHHHHHHH
Confidence            79999999999998863


No 40 
>PF14259 RRM_6:  RNA recognition motif (a.k.a. RRM, RBD, or RNP domain); PDB: 2DNN_A 1WI6_A 2EVZ_A 2ADC_A 1QM9_A 2KG1_A 2HGN_A 1U2F_A 2G4B_A 2HZC_A ....
Probab=35.74  E-value=41  Score=20.91  Aligned_cols=18  Identities=28%  Similarity=0.241  Sum_probs=16.6

Q ss_pred             eeeeCCHHHHHHHHHHcC
Q 032597          105 GLSFDSKEAAREFAERHG  122 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~G  122 (137)
                      -+.|.|.|+|...++.++
T Consensus        43 ~v~f~~~~~a~~al~~~~   60 (70)
T PF14259_consen   43 FVEFSSEEDAKRALELLN   60 (70)
T ss_dssp             EEEESSHHHHHHHHHHHT
T ss_pred             EEEeCCHHHHHHHHHHCC
Confidence            789999999999999887


No 41 
>PRK13864 type IV secretion system lytic transglycosylase VirB1; Provisional
Probab=35.74  E-value=51  Score=27.86  Aligned_cols=23  Identities=13%  Similarity=0.130  Sum_probs=18.4

Q ss_pred             eeeeCCHHHHHHHHHH---cCCcEEE
Q 032597          105 GLSFDSKEAAREFAER---HGWEYVV  127 (137)
Q Consensus       105 ~L~F~SkE~AIayaek---~Gw~Y~V  127 (137)
                      .|.|.++++||+.+++   .|..|.|
T Consensus        69 ~l~~qs~~EAi~~a~~l~~~g~s~Dv   94 (245)
T PRK13864         69 TLHWQNHAQATQSVRHRLEARHSLDV   94 (245)
T ss_pred             ccCCCCHHHHHHHHHHHHhcCCceee
Confidence            5789999999998864   6777766


No 42 
>PRK00823 phhB pterin-4-alpha-carbinolamine dehydratase; Validated
Probab=35.64  E-value=38  Score=23.92  Aligned_cols=34  Identities=32%  Similarity=0.520  Sum_probs=24.4

Q ss_pred             CCCcCccCCCCccCccCCceeeeCCHHHHHHHHHHc
Q 032597           86 NPLMGWTSTGDPYANVGDAGLSFDSKEAAREFAERH  121 (137)
Q Consensus        86 nPLMGWtsS~D~~sqv~~~~L~F~SkE~AIayaek~  121 (137)
                      ..|-||.-..|+.. + .-..+|++-.+|++|+.+-
T Consensus        16 ~~l~gW~~~~~~~~-l-~r~f~f~~f~~a~~f~~~V   49 (97)
T PRK00823         16 PQLPGWTLVGDRDA-I-ERTFKFKNFNEAFAFMNRV   49 (97)
T ss_pred             hcCCCCeEeCCcCe-E-EEEEEeCCHHHHHHHHHHH
Confidence            45679998877531 1 1278899999999987653


No 43 
>TIGR00746 arcC carbamate kinase. The seed alignment for this model includes experimentally confirmed examples from a set of phylogenetically distinct species. In a neighbor-joining tree constructed from an alignment of candidate carbamate kinases and several acetylglutamate kinases, the latter group forms a clear outgroup which roots the tree of carbamate kinase-like proteins. This analysis suggests that in E. coli, the ArcC paralog YqeA may be a second isozyme, while the paralog YahI branches as an outlier and is less likely to be an authentic carbamate kinase. The homolog from Mycoplasma pneumoniae likewise branches outside the set containing known carbamate kinases and also scores below the trusted cutoff.
Probab=35.26  E-value=35  Score=29.28  Aligned_cols=24  Identities=25%  Similarity=0.458  Sum_probs=20.2

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEeCC
Q 032597          107 SFDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      .|-|+|+|.+.++++||.|.-+.+
T Consensus       131 ~~y~~~~a~~~~~~~~~~~~~d~~  154 (310)
T TIGR00746       131 PFYTEEEAKRLAAEKGWIVKEDAG  154 (310)
T ss_pred             CCcCHHHHHHHHHHcCCeEeecCC
Confidence            689999999999999997665444


No 44 
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. Enabled-VASP-type homology (EVH1) domain. The EVH1 domain binds to other proteins at proline rich sequences. It is found in proteins involved in cytoskeletal reorganization such as Enabled and VASP. Ena-VASP type EVH1 domains specifically recognize FPPPP motifs in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes.  It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=34.96  E-value=29  Score=25.88  Aligned_cols=45  Identities=29%  Similarity=0.363  Sum_probs=27.3

Q ss_pred             CCCcEEEccCCC--Cc---cCCCcCccCCCCccCccCCceeeeCCHHHHHHHHHHc
Q 032597           71 LGRWKINFMSTQ--KW---ENPLMGWTSTGDPYANVGDAGLSFDSKEAAREFAERH  121 (137)
Q Consensus        71 ~~~W~LeFe~~~--rw---~nPLMGWtsS~D~~sqv~~~~L~F~SkE~AIayaek~  121 (137)
                      .++.+||.+-..  .+   .-.+.=|.+.   ..+.   -|.|.|+|||-+|.+..
T Consensus        54 ~~~~v~e~~l~~~l~y~k~~p~Fh~w~~~---~~v~---GLnF~Se~eA~~F~~~v  103 (111)
T cd01207          54 DHQVVINCAIVKGLKYNQATPTFHQWRDA---RQVY---GLNFGSKEDATMFASAM  103 (111)
T ss_pred             CCcEEEEEEecCCceeeecCCcceeeecC---CeEE---eeccCCHHHHHHHHHHH
Confidence            356677766421  11   1223334433   3455   89999999999998753


No 45 
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain. Large family of serine/threonine phosphatases, that includes PP1, PP2A and PP2B (calcineurin) family members.
Probab=34.32  E-value=67  Score=26.67  Aligned_cols=40  Identities=23%  Similarity=0.568  Sum_probs=27.8

Q ss_pred             CccCC---CcCccCCCCccCccCCceeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597           83 KWENP---LMGWTSTGDPYANVGDAGLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus        83 rw~nP---LMGWtsS~D~~sqv~~~~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      -|.||   .-||..|  + .   +....|. .+++.+|++++|+++.|.-
T Consensus       176 lWsDP~~~~~~~~~~--~-R---g~g~~fg-~~~~~~Fl~~n~l~~iiR~  218 (271)
T smart00156      176 LWSDPDQPVDGFQPS--I-R---GASYYFG-PDAVDEFLKKNNLKLIIRA  218 (271)
T ss_pred             eecCCCcccCCCccC--C-C---CCccccC-HHHHHHHHHHCCCeEEEec
Confidence            57777   3566544  2 1   2256775 6888899999999998864


No 46 
>PRK08179 prfH peptide chain release factor-like protein; Reviewed
Probab=34.01  E-value=31  Score=28.16  Aligned_cols=17  Identities=24%  Similarity=0.190  Sum_probs=14.5

Q ss_pred             HHHHHHcCCcEEEeCCC
Q 032597          115 REFAERHGWEYVVRKPH  131 (137)
Q Consensus       115 Iayaek~Gw~Y~V~~P~  131 (137)
                      ..||+++||+++|.+-.
T Consensus        27 ~~~a~~~g~~~~ii~~~   43 (200)
T PRK08179         27 LKEAARQGVRVTVLETE   43 (200)
T ss_pred             HHHHHHcCCeEEEEeCC
Confidence            57999999999997643


No 47 
>cd00913 PCD_DCoH_subfamily_a PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein).
Probab=33.86  E-value=54  Score=22.08  Aligned_cols=29  Identities=24%  Similarity=0.472  Sum_probs=20.9

Q ss_pred             CccCCCCccCccCCceeeeCCHHHHHHHHHH
Q 032597           90 GWTSTGDPYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        90 GWtsS~D~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      ||.-..|+.. + ....+|++-.+|++|+.+
T Consensus         1 gW~~~~~~~~-l-~r~f~f~~f~~a~~f~~~   29 (76)
T cd00913           1 GWELADDGLK-L-ERTFRFKNFVEALEFVNA   29 (76)
T ss_pred             CCcCcCCCCe-E-EEEEEcCCHHHHHHHHHH
Confidence            7887776521 1 126789999999999765


No 48 
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed
Probab=33.76  E-value=42  Score=24.31  Aligned_cols=26  Identities=27%  Similarity=0.409  Sum_probs=22.8

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeCC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      .+..++.+++.+|++++|+.|.+...
T Consensus        69 ~Is~d~~~~~~~~~~~~~~~~~~l~D   94 (154)
T PRK09437         69 GISTDKPEKLSRFAEKELLNFTLLSD   94 (154)
T ss_pred             EEcCCCHHHHHHHHHHhCCCCeEEEC
Confidence            67889999999999999999987653


No 49 
>PF02786 CPSase_L_D2:  Carbamoyl-phosphate synthase L chain, ATP binding domain;  InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the ATP-binding domain found in the large subunit of carbamoyl phosphate synthase, as well as in related proteins.; GO: 0003824 catalytic activity, 0005524 ATP binding, 0008152 metabolic process; PDB: 3U9S_A 3U9T_A 2C00_B 2VQD_A 1W96_B 1W93_A 1M6V_C 1CS0_C 1C30_E 1C3O_G ....
Probab=33.34  E-value=44  Score=26.76  Aligned_cols=21  Identities=38%  Similarity=0.570  Sum_probs=17.8

Q ss_pred             CCHHHHHHHHHHcCCcEEEeC
Q 032597          109 DSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .|.|+|++||++.|++.-|..
T Consensus        25 ~~~eea~~~a~~iGyPVliKa   45 (211)
T PF02786_consen   25 SSVEEALEFAEEIGYPVLIKA   45 (211)
T ss_dssp             SSHHHHHHHHHHH-SSEEEEE
T ss_pred             CCHHHHHHHHHhcCCceEEee
Confidence            689999999999999988754


No 50 
>PF09383 NIL:  NIL domain;  InterPro: IPR018449 This domain is found at the C terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins. This domain is likely to act as a substrate binding domain. The domain has been named after a conserved sequence in some members of the family. ; PDB: 2QRR_A 3CED_A 2QSW_A 3TUZ_D 3TUJ_D 3DHX_B 3TUI_H 3DHW_D.
Probab=33.00  E-value=40  Score=22.13  Aligned_cols=24  Identities=25%  Similarity=0.196  Sum_probs=18.5

Q ss_pred             eeeeC----CHHHHHHHHHHcCCcEEEe
Q 032597          105 GLSFD----SKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       105 ~L~F~----SkE~AIayaek~Gw~Y~V~  128 (137)
                      .+.+.    ..++|++|.+++|+.+||.
T Consensus        49 ~l~l~g~~~~~~~a~~~L~~~~v~vEvl   76 (76)
T PF09383_consen   49 ILELPGDDEEIEKAIAYLREQGVEVEVL   76 (76)
T ss_dssp             EEEEES-HHHHHHHHHHHHHTTEEEEEE
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCeEEEC
Confidence            56662    2478999999999998873


No 51 
>TIGR01465 cobM_cbiF precorrin-4 C11-methyltransferase. This model represents precorrin-4 C11-methyltransferase, one of two methyltransferases commonly referred to as precorrin-3 methylase (the other is precorrin-3B C17-methyltransferase, EC 2.1.1.131). This enzyme participates in the pathway toward the biosynthesis of cobalamin and related products.
Probab=32.70  E-value=60  Score=25.30  Aligned_cols=33  Identities=24%  Similarity=0.303  Sum_probs=26.1

Q ss_pred             cCccCCCCccCccCCceeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597           89 MGWTSTGDPYANVGDAGLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus        89 MGWtsS~D~~sqv~~~~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      ...-.+|||+        -|.+--.-+.+++++|++++|..
T Consensus        74 V~~L~~GDP~--------~~~~~~~l~~~~~~~g~~veviP  106 (229)
T TIGR01465        74 VVRLHTGDPS--------IYGAIAEQMQLLEALGIPYEVVP  106 (229)
T ss_pred             EEEEeCcCcc--------ccccHHHHHHHHHHCCCCEEEEC
Confidence            4556789996        47777788889999999999863


No 52 
>PF00076 RRM_1:  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain);  InterPro: IPR000504 Many eukaryotic proteins containing one or more copies of a putative RNA-binding domain of about 90 amino acids are known to bind single-stranded RNAs [, , ]. The largest group of single strand RNA-binding proteins is the eukaryotic RNA recognition motif (RRM) family that contains an eight amino acid RNP-1 consensus sequence [, ]. RRM proteins have a variety of RNA binding preferences and functions, and include heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing (SR, U2AF, Sxl), protein components of small nuclear ribonucleoproteins (U1 and U2 snRNPs), and proteins that regulate RNA stability and translation (PABP, La, Hu) [, , ]. The RRM in heterodimeric splicing factor U2 snRNP auxiliary factor (U2AF) appears to have two RRM-like domains with specialised features for protein recognition []. The motif also appears in a few single stranded DNA binding proteins. The typical RRM consists of four anti-parallel beta-strands and two alpha-helices arranged in a beta-alpha-beta-beta-alpha-beta fold with side chains that stack with RNA bases. Specificity of RNA binding is determined by multiple contacts with surrounding amino acids. A third helix is present during RNA binding in some cases []. The RRM is reviewed in a number of publications [, , ].; GO: 0003676 nucleic acid binding; PDB: 2RNE_A 2DGO_A 2DO4_A 1YTY_B 2VOO_B 2VOP_A 2VON_B 1ZH5_B 2VOD_A 1S79_A ....
Probab=32.53  E-value=51  Score=19.88  Aligned_cols=18  Identities=33%  Similarity=0.425  Sum_probs=15.6

Q ss_pred             eeeeCCHHHHHHHHH-HcC
Q 032597          105 GLSFDSKEAAREFAE-RHG  122 (137)
Q Consensus       105 ~L~F~SkE~AIayae-k~G  122 (137)
                      -+.|.+.|+|....+ -+|
T Consensus        43 ~V~F~~~~~a~~a~~~l~g   61 (70)
T PF00076_consen   43 FVEFESEEDAEKALEELNG   61 (70)
T ss_dssp             EEEESSHHHHHHHHHHHTT
T ss_pred             EEEEcCHHHHHHHHHHcCC
Confidence            789999999999888 565


No 53 
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. The EVH1 domain binds to other proteins at proline rich sequences in either FPPPP or PPXXF motifs. It is found in the cytoskeletal reorganization proteins Enabled VASP, and WASP, and in the synaptic scaffolding protein Homer. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=32.42  E-value=46  Score=23.68  Aligned_cols=16  Identities=44%  Similarity=0.812  Sum_probs=14.9

Q ss_pred             eeeeCCHHHHHHHHHH
Q 032597          105 GLSFDSKEAAREFAER  120 (137)
Q Consensus       105 ~L~F~SkE~AIayaek  120 (137)
                      .|.|.|.|||-+|.++
T Consensus        84 GL~F~se~eA~~F~~~   99 (104)
T cd00837          84 GLNFASEEEAAQFRKK   99 (104)
T ss_pred             EEeeCCHHHHHHHHHH
Confidence            8999999999999876


No 54 
>PLN00200 argininosuccinate synthase; Provisional
Probab=32.18  E-value=31  Score=30.81  Aligned_cols=20  Identities=20%  Similarity=0.351  Sum_probs=17.1

Q ss_pred             eeCCHHHHHHHHHHcCCcEE
Q 032597          107 SFDSKEAAREFAERHGWEYV  126 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~  126 (137)
                      .|.||++.++||+++|++..
T Consensus       152 ~~~~r~e~~~~A~~~Gipv~  171 (404)
T PLN00200        152 DIKGREDLIEYAKKHNIPVP  171 (404)
T ss_pred             CCCCHHHHHHHHHHcCCCCC
Confidence            35599999999999999754


No 55 
>COG0007 CysG Uroporphyrinogen-III methylase [Coenzyme metabolism]
Probab=31.73  E-value=62  Score=27.28  Aligned_cols=28  Identities=32%  Similarity=0.459  Sum_probs=23.4

Q ss_pred             CCCccCccCCceeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597           94 TGDPYANVGDAGLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus        94 S~D~~sqv~~~~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      +|||+        -|.=--+=++++.++|++|+|..
T Consensus        89 gGDP~--------iFGRggEE~~~l~~~gI~~eVVP  116 (244)
T COG0007          89 GGDPY--------IFGRGGEEIEALAEAGIEFEVVP  116 (244)
T ss_pred             CCCCC--------eecCcHHHHHHHHHcCCceEEeC
Confidence            38887        57777788899999999999974


No 56 
>COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]
Probab=31.17  E-value=35  Score=27.59  Aligned_cols=21  Identities=33%  Similarity=0.468  Sum_probs=17.7

Q ss_pred             eeeeCCHHHHHHHHHHcCCcE
Q 032597          105 GLSFDSKEAAREFAERHGWEY  125 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y  125 (137)
                      .+-|.++|+|.+|+.++|=..
T Consensus       130 A~pF~~e~aA~~faa~~GGrv  150 (176)
T COG4314         130 ASPFSDEEAAERFAADNGGRV  150 (176)
T ss_pred             cccccCHHHHHHHHHhcCCeE
Confidence            345999999999999999543


No 57 
>cd00914 PCD_DCoH_subfamily_b PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein). Two DCoH proteins have been identifed in humans: DCoH1 and DCoH2. Mutations in human DCoH1 cause hyperphenylalaninemia. Loss of enzymic activity of DCoH in humans is associated with the depigmentation disorder vitiligo. DCoH1 has been reported to be overexpessed in colon
Probab=30.89  E-value=52  Score=22.20  Aligned_cols=29  Identities=28%  Similarity=0.468  Sum_probs=21.0

Q ss_pred             CccCCCCccCccCCceeeeCCHHHHHHHHHH
Q 032597           90 GWTSTGDPYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        90 GWtsS~D~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      ||.-..|+.. + ....+|++-.+|++|..+
T Consensus         1 gW~~~~~~~~-l-~r~f~f~~f~~a~~f~~~   29 (76)
T cd00914           1 GWTLVDGRDA-I-HKSFKFKDFNEAFGFMTR   29 (76)
T ss_pred             CCeEeCCCCe-E-EEEEEeCCHHHHHHHHHH
Confidence            6877776531 1 127899999999999765


No 58 
>PRK01792 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=30.48  E-value=42  Score=27.76  Aligned_cols=18  Identities=22%  Similarity=0.451  Sum_probs=16.4

Q ss_pred             eCCHHHHHHHHHHcCCcE
Q 032597          108 FDSKEAAREFAERHGWEY  125 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y  125 (137)
                      ...++++++||++||+++
T Consensus       182 ma~~~~~~~fA~~~~l~~  199 (214)
T PRK01792        182 MARTPEIVEFAKKFGYAV  199 (214)
T ss_pred             ccCHHHHHHHHHHcCCcE
Confidence            567899999999999988


No 59 
>TIGR00506 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase. Several members of the family are bifunctional, involving both ribA and ribB function. In these cases, ribA tends to be on the C-terminal end of the protein and ribB tends to be on the N-terminal.
Probab=30.48  E-value=46  Score=27.11  Aligned_cols=18  Identities=22%  Similarity=0.423  Sum_probs=16.2

Q ss_pred             eCCHHHHHHHHHHcCCcE
Q 032597          108 FDSKEAAREFAERHGWEY  125 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y  125 (137)
                      ..+++++.+||++||+++
T Consensus       172 m~~~~~~~~fA~~~~l~~  189 (199)
T TIGR00506       172 MARKPELMEYAKKHNLKL  189 (199)
T ss_pred             ccCHHHHHHHHHHcCCcE
Confidence            567899999999999987


No 60 
>PF10009 DUF2252:  Uncharacterized protein conserved in bacteria (DUF2252);  InterPro: IPR018721 This domain has no known function.
Probab=29.45  E-value=29  Score=30.50  Aligned_cols=42  Identities=21%  Similarity=0.401  Sum_probs=27.4

Q ss_pred             CCccCCCcCccCCCCc---cCccCCceeeeC----CHHHHHHHHHHcCC
Q 032597           82 QKWENPLMGWTSTGDP---YANVGDAGLSFD----SKEAAREFAERHGW  123 (137)
Q Consensus        82 ~rw~nPLMGWtsS~D~---~sqv~~~~L~F~----SkE~AIayaek~Gw  123 (137)
                      +.-.||++||++-++-   ..|...+..+|+    +.++...||+-.|+
T Consensus       287 q~~sD~~LG~~~~~g~~f~VRql~p~k~~~d~~~l~~~~~~~~a~~~g~  335 (385)
T PF10009_consen  287 QAASDPFLGWVTIDGRDFYVRQLRPMKGSVDLEDLDPEELQDYARLCGR  335 (385)
T ss_pred             hhcCCcccCceeeCCceEEEEECCCcCCCcChhhCCHHHHHHHHHHHHH
Confidence            3557999999997661   122222233333    67889999988775


No 61 
>TIGR03072 release_prfH putative peptide chain release factor H. Members of this protein family are bacterial proteins homologous to peptide chain release factors 1 (RF-1, product of the prfA gene), and 2 (RF-2, product of the prfB gene). The member from Escherichia coli K-12, designated prfH, appears to be a pseudogene. This class I release factor is always found as the downstream gene of a two-gene operon.
Probab=29.29  E-value=41  Score=27.43  Aligned_cols=17  Identities=18%  Similarity=0.055  Sum_probs=14.6

Q ss_pred             HHHHHHcCCcEEEeCCC
Q 032597          115 REFAERHGWEYVVRKPH  131 (137)
Q Consensus       115 Iayaek~Gw~Y~V~~P~  131 (137)
                      ..||+++||+++|.+-.
T Consensus        26 ~~~a~~~g~~~eii~~~   42 (200)
T TIGR03072        26 TREAAARGVRVEVLEQE   42 (200)
T ss_pred             HHHHHHcCCeEEEEeCC
Confidence            57999999999997744


No 62 
>PF14657 Integrase_AP2:  AP2-like DNA-binding integrase domain
Probab=29.19  E-value=45  Score=20.36  Aligned_cols=13  Identities=23%  Similarity=0.427  Sum_probs=11.9

Q ss_pred             eCCHHHHHHHHHH
Q 032597          108 FDSKEAAREFAER  120 (137)
Q Consensus       108 F~SkE~AIayaek  120 (137)
                      |.|+.||.+++.+
T Consensus        24 F~TkkeA~~~~~~   36 (46)
T PF14657_consen   24 FKTKKEAEKALAK   36 (46)
T ss_pred             CCcHHHHHHHHHH
Confidence            9999999999875


No 63 
>PF14791 DNA_pol_B_thumb:  DNA polymerase beta thumb ; PDB: 1HUZ_A 3K75_D 1HUO_A 2BPC_A 1RPL_A 1NOM_A 1ZQX_A 1ZQU_A 1ZQZ_A 1ZQV_A ....
Probab=29.03  E-value=5.9  Score=26.55  Aligned_cols=11  Identities=18%  Similarity=0.220  Sum_probs=6.3

Q ss_pred             CcCccCCCCcc
Q 032597           88 LMGWTSTGDPY   98 (137)
Q Consensus        88 LMGWtsS~D~~   98 (137)
                      |.+||||.+-.
T Consensus         2 ll~~TGs~~fn   12 (64)
T PF14791_consen    2 LLYFTGSKEFN   12 (64)
T ss_dssp             HHHHHS-HHHH
T ss_pred             cccccCCHHHH
Confidence            45677776654


No 64 
>KOG1706 consensus Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=29.00  E-value=33  Score=30.78  Aligned_cols=23  Identities=26%  Similarity=0.460  Sum_probs=20.2

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEeC
Q 032597          107 SFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      +|.-++|+++||++||++.-|..
T Consensus       154 rf~Gr~Dl~eYakq~giPvpvT~  176 (412)
T KOG1706|consen  154 RFKGRKDLLEYAKQHGIPVPVTP  176 (412)
T ss_pred             hhcCchHHHHHHHhcCCCccccC
Confidence            68999999999999999987643


No 65 
>PF12123 Amidase02_C:  N-acetylmuramoyl-l-alanine amidase;  InterPro: IPR021976  This domain is found in bacteria and viruses. This domain is about 50 amino acids in length. This domain is classified with the enzyme classification code 3.5.1.28 from EC. This domain is the C-terminal of the enzyme which hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. ; PDB: 2L48_B.
Probab=28.77  E-value=68  Score=20.45  Aligned_cols=18  Identities=22%  Similarity=0.553  Sum_probs=13.8

Q ss_pred             CHHHHHHHHHHcCCcEEE
Q 032597          110 SKEAAREFAERHGWEYVV  127 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~V  127 (137)
                      .++.+-+|-+++||-|+|
T Consensus        28 ~L~k~~~wld~rgWwYe~   45 (45)
T PF12123_consen   28 ELDKFTAWLDERGWWYEV   45 (45)
T ss_dssp             HHHHHHHHHHHTT--EEE
T ss_pred             HHHHHHHHHHhcCcEEeC
Confidence            367889999999999987


No 66 
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=28.68  E-value=41  Score=27.24  Aligned_cols=42  Identities=26%  Similarity=0.401  Sum_probs=26.0

Q ss_pred             cCCCcCccCCCCccCccCCceeee-----------CCHHHHHHHHHHcCCcEE
Q 032597           85 ENPLMGWTSTGDPYANVGDAGLSF-----------DSKEAAREFAERHGWEYV  126 (137)
Q Consensus        85 ~nPLMGWtsS~D~~sqv~~~~L~F-----------~SkE~AIayaek~Gw~Y~  126 (137)
                      .|.|..|-..+-.+.|-+...+-.           -+-|+|.+|||+||+-|.
T Consensus        99 ynhlsswl~dar~ltnpnt~i~lignkadle~qrdv~yeeak~faeengl~fl  151 (215)
T KOG0097|consen   99 YNHLSSWLTDARNLTNPNTVIFLIGNKADLESQRDVTYEEAKEFAEENGLMFL  151 (215)
T ss_pred             hhhHHHHHhhhhccCCCceEEEEecchhhhhhcccCcHHHHHHHHhhcCeEEE
Confidence            377777766554443321111111           256899999999999875


No 67 
>COG0216 PrfA Protein chain release factor A [Translation, ribosomal structure and biogenesis]
Probab=28.66  E-value=44  Score=29.86  Aligned_cols=18  Identities=22%  Similarity=0.597  Sum_probs=15.1

Q ss_pred             HHHHHHcCCcEEEeCCCC
Q 032597          115 REFAERHGWEYVVRKPHR  132 (137)
Q Consensus       115 Iayaek~Gw~Y~V~~P~~  132 (137)
                      ..||+.+||.++|..-..
T Consensus       139 ~rYAe~kgWk~ei~s~se  156 (363)
T COG0216         139 SRYAESKGWKVEILSASE  156 (363)
T ss_pred             HHHHHhCCCEEEEeecCc
Confidence            379999999999987554


No 68 
>PF10566 Glyco_hydro_97:  Glycoside hydrolase 97  ;  InterPro: IPR019563 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  This is the 97th family of glycosidases, in this case bacterial. The central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, most probably form two additional non-catalytic domains with as yet unknown functions. The non-catalytic domains of glycosidases from the alpha-galactosidase and alpha-glucosidase superfamilies are also predominantly composed of beta-strands, and at least some of these domains are involved in oligomerisation and carbohydrate binding. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands []. ; PDB: 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A 3A24_A.
Probab=28.57  E-value=53  Score=27.92  Aligned_cols=25  Identities=28%  Similarity=0.501  Sum_probs=20.8

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .+.+++-..=|+||.++||+|.+..
T Consensus        28 g~~t~~~k~yIDfAa~~G~eYvlvD   52 (273)
T PF10566_consen   28 GATTETQKRYIDFAAEMGIEYVLVD   52 (273)
T ss_dssp             SSSHHHHHHHHHHHHHTT-SEEEEB
T ss_pred             CCCHHHHHHHHHHHHHcCCCEEEec
Confidence            4578888899999999999999874


No 69 
>PF01329 Pterin_4a:  Pterin 4 alpha carbinolamine dehydratase;  InterPro: IPR001533 DCoH is the dimerisation cofactor of hepatocyte nuclear factor 1 (HNF-1) that functions as both a transcriptional coactivator and a pterin dehydratase []. X-ray crystallographic studies have shown that the ligand binds at four sites per tetrameric enzyme, with little apparent conformational change in the protein.; GO: 0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity, 0006729 tetrahydrobiopterin biosynthetic process; PDB: 2V6T_B 2V6U_A 2V6S_B 2EBB_A 1USM_A 1F93_B 1DCP_C 1DCH_E 3HXA_E 1DCO_C ....
Probab=28.40  E-value=53  Score=23.04  Aligned_cols=31  Identities=29%  Similarity=0.518  Sum_probs=22.4

Q ss_pred             CCCcCccCCC-CccCccCCceeeeCCHHHHHHHHHH
Q 032597           86 NPLMGWTSTG-DPYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        86 nPLMGWtsS~-D~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      ..|-||.-.+ .-+..    ...|++-..|++|..+
T Consensus        15 ~~l~~W~~~~~~~l~r----~f~f~~f~~a~~f~~~   46 (95)
T PF01329_consen   15 AELPGWKLDGGGRLER----TFKFKDFAEAVEFVNR   46 (95)
T ss_dssp             HTSTTSEEETSSEEEE----EEE-SSHHHHHHHHHH
T ss_pred             hcCcCCEECCCCcEEE----EEEeCCHHHHHHHHHH
Confidence            3678999888 33332    7899999999999754


No 70 
>cd03421 SirA_like_N SirA_like_N, a protein of unknown function with an N-terminal SirA-like domain.  The SirA, YedF, YeeD protein family is present in bacteria as well as archaea. SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA.  A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=28.34  E-value=61  Score=20.78  Aligned_cols=21  Identities=38%  Similarity=0.602  Sum_probs=17.1

Q ss_pred             CHHHHHHHHHHcCCcEEEeCC
Q 032597          110 SKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      +.++=.+||+++|+.+++.+.
T Consensus        37 s~~~i~~~~~~~G~~~~~~~~   57 (67)
T cd03421          37 AKENVSRFAESRGYEVSVEEK   57 (67)
T ss_pred             HHHHHHHHHHHcCCEEEEEec
Confidence            346888999999999987654


No 71 
>cd06576 PASTA_Pbp2x-like_1 PASTA domain of PBP2x-like proteins, first repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are connected to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=28.04  E-value=94  Score=18.08  Aligned_cols=22  Identities=27%  Similarity=0.206  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHHcCCcEEEeCC
Q 032597          109 DSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      .+.++|.+.+++.|+.+++..+
T Consensus         8 ~~~~~a~~~l~~~g~~~~~~~~   29 (55)
T cd06576           8 KSVEEAKKELKEAGLQPVVIGN   29 (55)
T ss_pred             CCHHHHHHHHHHCCCEEEEeCC
Confidence            4789999999999999987654


No 72 
>PF03795 YCII:  YCII-related domain;  InterPro: IPR005545 The majority of proteins in this group contain a single copy of this domain, though it is also found as a repeat (e.g. in Q9AJZ7 from SWISSPROT). A strongly conserved histidine and a aspartate suggest that the domain has an enzymatic function. This entry also covers what was previously known as the DGPF domain (COG3795). Although its function is unknown it is found fused to a sigma-70 factor family domain in Q9A8M4 from SWISSPROT, suggesting that this domain may plays a role in transcription initiation. This domain is named after the most conserved motif in the alignment.; PDB: 1S7I_A 1MWQ_A.
Probab=27.92  E-value=41  Score=22.57  Aligned_cols=17  Identities=29%  Similarity=0.335  Sum_probs=14.7

Q ss_pred             ceeeeCCHHHHHHHHHH
Q 032597          104 AGLSFDSKEAAREFAER  120 (137)
Q Consensus       104 ~~L~F~SkE~AIayaek  120 (137)
                      ..+..+|+|+|+++|++
T Consensus        61 ~i~~a~s~e~A~~~~~~   77 (95)
T PF03795_consen   61 IIVEAESREEAEEIAKE   77 (95)
T ss_dssp             EEEEESSHHHHHHHHCT
T ss_pred             EEEEeCCHHHHHHHHHh
Confidence            36789999999999975


No 73 
>PTZ00056 glutathione peroxidase; Provisional
Probab=27.90  E-value=56  Score=25.66  Aligned_cols=21  Identities=19%  Similarity=0.436  Sum_probs=18.8

Q ss_pred             eCCHHHHHHHHHHcCCcEEEe
Q 032597          108 FDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      +++.|++.+|++++|+.|.|.
T Consensus        88 ~d~~e~~~~f~~~~~~~fpvl  108 (199)
T PTZ00056         88 FPNTKDIRKFNDKNKIKYNFF  108 (199)
T ss_pred             CCCHHHHHHHHHHcCCCceee
Confidence            478899999999999999984


No 74 
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=27.70  E-value=88  Score=20.63  Aligned_cols=24  Identities=33%  Similarity=0.483  Sum_probs=19.2

Q ss_pred             eeee--CCHHHHHHHHHHcCCcEEEe
Q 032597          105 GLSF--DSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       105 ~L~F--~SkE~AIayaek~Gw~Y~V~  128 (137)
                      .++|  ..+|.++.+.+++|+.|+=.
T Consensus        44 al~~~~~d~~~i~~~l~~~~i~~~~i   69 (73)
T PF11823_consen   44 ALRFEPEDLEKIKEILEENGIEYEGI   69 (73)
T ss_pred             EEEEChhhHHHHHHHHHHCCCCeeEE
Confidence            4555  67899999999999998643


No 75 
>TIGR03798 ocin_TIGR03798 bacteriocin propeptide, TIGR03798 family. This model describes a conserved, fairly long (about 65 residue) propeptide region for a family of putative microcins, that is, bacteriocins of small size. Members of the seed alignment tend to have the Gly-Gly motif as the last two residues of the matched region. This is a cleavage site for a combination processing/export ABC transporter with a peptidase domain.
Probab=27.58  E-value=28  Score=22.76  Aligned_cols=22  Identities=18%  Similarity=0.339  Sum_probs=18.8

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      ...+.|+-|++|+.+|+++...
T Consensus        23 ~~~~~e~~~~lA~~~Gf~ft~~   44 (64)
T TIGR03798        23 AAEDPEDRVAIAKEAGFEFTGE   44 (64)
T ss_pred             HcCCHHHHHHHHHHcCCCCCHH
Confidence            4678999999999999998654


No 76 
>PF13911 AhpC-TSA_2:  AhpC/TSA antioxidant enzyme
Probab=27.38  E-value=39  Score=23.54  Aligned_cols=29  Identities=17%  Similarity=0.269  Sum_probs=23.8

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeCCCCC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRKPHRP  133 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~P~~~  133 (137)
                      .+.+.+.|.+-+||+..+|+|.|-...++
T Consensus        18 ~I~~g~~~~~~~f~~~~~~p~~ly~D~~~   46 (115)
T PF13911_consen   18 VIGCGSPEGIEKFCELTGFPFPLYVDPER   46 (115)
T ss_pred             EEEcCCHHHHHHHHhccCCCCcEEEeCcH
Confidence            56789998899999999999997654443


No 77 
>PRK00910 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=27.03  E-value=52  Score=27.28  Aligned_cols=19  Identities=11%  Similarity=0.176  Sum_probs=16.8

Q ss_pred             eCCHHHHHHHHHHcCCcEE
Q 032597          108 FDSKEAAREFAERHGWEYV  126 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~  126 (137)
                      ...++++++||++||+.+.
T Consensus       183 ma~~~~l~~fA~~h~l~~i  201 (218)
T PRK00910        183 MAKTPEIIAFGKLHNMPVL  201 (218)
T ss_pred             cCCHHHHHHHHHHcCCcEE
Confidence            5689999999999999873


No 78 
>PF00926 DHBP_synthase:  3,4-dihydroxy-2-butanone 4-phosphate synthase;  InterPro: IPR000422 3,4-dihydroxy-2-butanone 4-phosphate synthase (4.1.99.12 from EC) (DHBP synthase) (RibB) catalyses the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate, the latter serving as the biosynthetic precursor for the xylene ring of riboflavin []. In Photobacterium leiognathi, the riboflavin synthesis genes ribB (DHBP synthase), ribE (riboflavin synthase), ribH (lumazone synthase) and ribA (GTP cyclohydrolase II) all reside in the lux operon []. RibB is sometimes found as a bifunctional enzyme with GTP cyclohydrolase II that catalyses the first committed step in the biosynthesis of riboflavin (IPR000926 from INTERPRO). No sequences with significant homology to DHBP synthase are found in the metazoa.; GO: 0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity, 0009231 riboflavin biosynthetic process; PDB: 1K4O_A 1K4L_A 1K4P_A 1K49_A 1K4I_A 1TKU_A 1TKS_B 2RIS_A 2RIU_A 3MIO_A ....
Probab=26.94  E-value=57  Score=26.40  Aligned_cols=19  Identities=32%  Similarity=0.644  Sum_probs=15.2

Q ss_pred             eCCHHHHHHHHHHcCCcEE
Q 032597          108 FDSKEAAREFAERHGWEYV  126 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~  126 (137)
                      -.+++++.+||++||+.+.
T Consensus       167 ~~~~~~~~~fA~~~~l~~v  185 (194)
T PF00926_consen  167 MARRDELEEFAKKHGLPIV  185 (194)
T ss_dssp             BHCHHHHHHHHHHTT-EEE
T ss_pred             cCCHHHHHHHHHHcCCcEE
Confidence            3578999999999999864


No 79 
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed
Probab=26.74  E-value=55  Score=28.39  Aligned_cols=22  Identities=27%  Similarity=0.545  Sum_probs=18.9

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      .|-|+|+|.+.++++||.|.-.
T Consensus       134 ~~y~~~~a~~~~~~~g~~~~~d  155 (313)
T PRK12454        134 PFYDEEEAKKLAKEKGWIVKED  155 (313)
T ss_pred             CCcCHHHHHHHHHHcCCEEEEc
Confidence            5999999999999999966543


No 80 
>PRK00014 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=26.10  E-value=55  Score=27.42  Aligned_cols=18  Identities=11%  Similarity=0.195  Sum_probs=16.4

Q ss_pred             eCCHHHHHHHHHHcCCcE
Q 032597          108 FDSKEAAREFAERHGWEY  125 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y  125 (137)
                      ...++++++||++||+.+
T Consensus       187 ma~~~~l~~fA~~~~l~i  204 (230)
T PRK00014        187 MMRGASLERYAAKEGLVA  204 (230)
T ss_pred             ccCHHHHHHHHHHcCCcE
Confidence            567899999999999988


No 81 
>PF02177 APP_N:  Amyloid A4 N-terminal heparin-binding;  InterPro: IPR015849 Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [, ]. Mutations in APP or in proteins that process APP have been linked with early-onset, familial AD. Individuals with Down's syndrome carry an extra copy of chromosome 21, which contains the APP gene, and almost invariably develop amyloid plaques and Alzheimer's symptoms.  APP is important for the neurogenesis and neuronal regeneration, either through the intact protein, or through its many breakdown products []. APP consists of a large N-terminal extracellular region containing heparin-binding and copper-binding sites, a short hydrophobic transmembrane domain, and a short C-terminal intracellular domain. The N-terminal region is similar in structure to cysteine-rich growth factors and appears to function as a cell surface receptor, contributing to neurite growth, neuronal adhesion, axonogenesis and cell mobility []. APP acts as a kinesin I membrane receptor to mediate the axonal transport of beta-secretase and presenilin 1. The N-terminal domain can regulate neurite outgrowth through its binding to heparin and collagen I and IV, which are components of the extracellular matrix. APP is also coupled to apoptosis-inducing pathways, and is involved in copper homeostasis/oxidative stress through copper ion reduction, where copper-metallated APP induces neuronal death []. The C-terminal intracellular domain appears to be involved in transcription regulation through protein-protein interactions. APP can promote transcription activation through binding to APBB1/Tip60, and may bind to the adaptor protein FE65 to transactivate a wide variety of different promoters. APP can be processed by different sets of enzymes:    In the non-amyloidogenic (non-plaque-forming) pathway, APP is cleaved by alpha-secretase to yield a soluble N-terminal sAPP-alpha (neuroprotective) and a membrane-bound CTF-alpha. CTF-alpha is broken-down by presenilin-containing gamma-secretase to yield soluble p3 and membrane-bound AICD (nuclear signalling).  In the amyloidogenic pathway (plaque-forming), APP is broken down by beta-secretase to yield soluble sAPP-beta and membrane-bound CTF-beta. CTF-beta is broken down by gamma-secretase to yield soluble amyloid-beta and membrane-bound AICD. Amyloid-beta is required for neuronal function, but can aggregate to form amyloid plaques that seem to disrupt brain cells by clogging points of cell-cell contact.   This entry represents a heparin-binding domain found at the N-terminal of the extracellular domain, which is itself found at the N-terminal of amyloidogenic glycoproteins such as amyloid-beta precursor protein (APP, or A4). The core of the heparin-binding domain has an unusual disulphide-rich fold, consisting of a beta-x-alpha-beta-loop-beta topology [].  More information about these protein can be found at Protein of the Month: Amyloid-beta Precursor Protein [].; GO: 0005488 binding, 0016021 integral to membrane; PDB: 3KTM_E 1MWP_A 2FKL_A 1OWT_A.
Probab=25.88  E-value=56  Score=24.27  Aligned_cols=23  Identities=13%  Similarity=0.138  Sum_probs=15.7

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEE
Q 032597          105 GLSFDSKEAAREFAERHGWEYVV  127 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V  127 (137)
                      .--|.++++.++||++.--++.|
T Consensus        31 ~~C~~~k~eIL~YCrkvYP~l~I   53 (102)
T PF02177_consen   31 ASCLKDKEEILKYCRKVYPELQI   53 (102)
T ss_dssp             -B---SHHHHHHHHHHHSTTS-E
T ss_pred             ccccCChHHHHHHHHHhCCCCce
Confidence            45899999999999998777655


No 82 
>PF12745 HGTP_anticodon2:  Anticodon binding domain of tRNAs;  InterPro: IPR024435 This is an anticodon binding domain, found largely on Gcn2 proteins which bind tRNA to down regulate translation in certain stress situations [].; GO: 0000049 tRNA binding
Probab=25.81  E-value=75  Score=26.81  Aligned_cols=23  Identities=17%  Similarity=0.372  Sum_probs=20.6

Q ss_pred             CCHHHHHHHHHHcCCcEEEeCCC
Q 032597          109 DSKEAAREFAERHGWEYVVRKPH  131 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~P~  131 (137)
                      .|.||.+.+|..+|+.|.|.--+
T Consensus        44 ~S~Eel~~~~~~~gi~wiViikq   66 (273)
T PF12745_consen   44 PSQEELQSYCREDGISWIVIIKQ   66 (273)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEec
Confidence            59999999999999999987655


No 83 
>cd01206 Homer Homer type EVH1 domain. Homer type EVH1 domain. Homer is a synaptic scaffolding protein, involved in neuronal signaling. It contains an  EVH1 domain, which binds to both neurotransmitter receptors, such as the metabotropic glutamate receptor (mGluR) and to other scaffolding proteins via PPXXF motifs, in order to target them to the synaptic junction. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=25.74  E-value=74  Score=24.05  Aligned_cols=23  Identities=43%  Similarity=0.671  Sum_probs=17.7

Q ss_pred             CccC-ccCCceeeeCCHHHHHHHHHH
Q 032597           96 DPYA-NVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        96 D~~s-qv~~~~L~F~SkE~AIayaek  120 (137)
                      |+.+ +|  -.|.|.|+|||=.|+++
T Consensus        79 D~R~~tV--yGLnF~Sk~ea~~F~~~  102 (111)
T cd01206          79 DSRANTV--YGLGFSSEQQLTKFAEK  102 (111)
T ss_pred             cccccee--eecccCCHHHHHHHHHH
Confidence            5552 34  36899999999999986


No 84 
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of  thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein,  Dot5p (for disrupter of telomere silencing protein 5), w
Probab=25.40  E-value=77  Score=22.09  Aligned_cols=26  Identities=35%  Similarity=0.484  Sum_probs=22.3

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeCC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      .+..++.+++.+|++++|+.|.+...
T Consensus        62 ~is~d~~~~~~~~~~~~~~~~~~l~D   87 (140)
T cd03017          62 GVSPDSVESHAKFAEKYGLPFPLLSD   87 (140)
T ss_pred             EEcCCCHHHHHHHHHHhCCCceEEEC
Confidence            56678999999999999999987654


No 85 
>PF09691 PulS_OutS:  Bacterial chaperone lipoprotein (PulS_OutS);  InterPro: IPR019114  This family comprises lipoproteins from gamma proteobacterial species: pullulanase secretion protein PulS protein of Klebsiella pneumoniae (P20440 from SWISSPROT), the lipoprotein OutS protein of Erwinia chrysanthemi (Q01567 from SWISSPROT) and the functionally uncharacterised type II secretion protein EtpO (Q7BSV3 from SWISSPROT) from Escherichia coli O157:H7. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.  In addition to the PulS/OutS proteins this entry also includes other functionally uncharacterised proteins, such as YacC from Escherischia coli (P0AA95 from SWISSPROT).; PDB: 3SOL_A 3UYM_A 3UTK_A 4A56_A.
Probab=24.96  E-value=47  Score=24.75  Aligned_cols=14  Identities=43%  Similarity=0.840  Sum_probs=10.4

Q ss_pred             HHHHHHHHHcCCcE
Q 032597          112 EAAREFAERHGWEY  125 (137)
Q Consensus       112 E~AIayaek~Gw~Y  125 (137)
                      -.||.||+++||+.
T Consensus        53 ~~a~~~A~~~gWd~   66 (109)
T PF09691_consen   53 RAAVIFAQQRGWDT   66 (109)
T ss_dssp             HHHHHHHHHTT--C
T ss_pred             HHHHHHHHHcCCCc
Confidence            36999999999985


No 86 
>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins.  Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain.
Probab=24.72  E-value=85  Score=21.96  Aligned_cols=24  Identities=17%  Similarity=0.315  Sum_probs=19.4

Q ss_pred             eCCHHHHHHHHH---HcCCcEEEeCCC
Q 032597          108 FDSKEAAREFAE---RHGWEYVVRKPH  131 (137)
Q Consensus       108 F~SkE~AIayae---k~Gw~Y~V~~P~  131 (137)
                      ..|+++|+.||.   ++|+-+-|..-+
T Consensus        46 ~~~R~eAv~~g~~Ll~~G~i~HV~~~h   72 (84)
T cd04438          46 LTDRREARKYASSLLKLGYIRHTVNKI   72 (84)
T ss_pred             CCCHHHHHHHHHHHHHCCcEEecCCCc
Confidence            579999999998   678888776544


No 87 
>PF08759 DUF1792:  Domain of unknown function (DUF1792);  InterPro: IPR014869 This domain is found at the C terminus of proteins such as Q97P75 from SWISSPROT that also contain the glycosyl transferase domain at the N terminus. Sometimes it is found independently. 
Probab=24.59  E-value=40  Score=28.21  Aligned_cols=26  Identities=19%  Similarity=0.359  Sum_probs=20.5

Q ss_pred             ccccCCCccccc--ceE-EEecCCCCCCC
Q 032597           40 GMVSGIPEEHLR--RRV-VIYTPARTATQ   65 (137)
Q Consensus        40 ~~vSG~P~e~~~--R~v-rIY~Pak~amQ   65 (137)
                      +.-+|+-.|+..  +.| |||-|+|+|=+
T Consensus       125 ~sR~GvgnDLFdnaksI~rIicPsknAf~  153 (225)
T PF08759_consen  125 KSRSGVGNDLFDNAKSIKRIICPSKNAFS  153 (225)
T ss_pred             CeecCCCchhhhCccceEEEECCchhhHH
Confidence            456889999884  566 89999999843


No 88 
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=24.27  E-value=58  Score=27.19  Aligned_cols=103  Identities=20%  Similarity=0.238  Sum_probs=59.3

Q ss_pred             cccccccccccccccccccccccCCCccccc-ce--EEEecCC-----CCCCCCCCCCCCCcEEEccCCCCc-cCCCcCc
Q 032597           21 PFSRAFSADALVEVKPGEIGMVSGIPEEHLR-RR--VVIYTPA-----RTATQQGSGKLGRWKINFMSTQKW-ENPLMGW   91 (137)
Q Consensus        21 ~~~r~fs~d~~~~~~~~e~~~vSG~P~e~~~-R~--vrIY~Pa-----k~amQSG~~~~~~W~LeFe~~~rw-~nPLMGW   91 (137)
                      ++.+.|......+.....+|+--|+..-+.. |.  +.|+-.+     ++.+-|--.....=.|-|+-..+- -|.|--|
T Consensus        21 clllrf~~krF~~~hd~TiGvefg~r~~~id~k~IKlqiwDtaGqe~frsv~~syYr~a~GalLVydit~r~sF~hL~~w  100 (216)
T KOG0098|consen   21 CLLLRFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSVTRSYYRGAAGALLVYDITRRESFNHLTSW  100 (216)
T ss_pred             HHHHHHhccCccccccceeeeeeceeEEEEcCceEEEEEEecCCcHHHHHHHHHHhccCcceEEEEEccchhhHHHHHHH
Confidence            3578888877777777778888888876664 43  4677532     122222222233345566654332 2566666


Q ss_pred             cCCCCccCccCCceee--------------eCCHHHHHHHHHHcCCcEE
Q 032597           92 TSTGDPYANVGDAGLS--------------FDSKEAAREFAERHGWEYV  126 (137)
Q Consensus        92 tsS~D~~sqv~~~~L~--------------F~SkE~AIayaek~Gw~Y~  126 (137)
                      -.-.-..++-   +|.              ==++||-.+||++||+-|-
T Consensus       101 L~D~rq~~~~---NmvImLiGNKsDL~~rR~Vs~EEGeaFA~ehgLifm  146 (216)
T KOG0098|consen  101 LEDARQHSNE---NMVIMLIGNKSDLEARREVSKEEGEAFAREHGLIFM  146 (216)
T ss_pred             HHHHHHhcCC---CcEEEEEcchhhhhccccccHHHHHHHHHHcCceee
Confidence            4321111100   111              2378999999999999885


No 89 
>PF14542 Acetyltransf_CG:  GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A.
Probab=24.06  E-value=69  Score=21.65  Aligned_cols=17  Identities=35%  Similarity=0.477  Sum_probs=13.4

Q ss_pred             HHHHHHHHHHcCCcEEE
Q 032597          111 KEAAREFAERHGWEYVV  127 (137)
Q Consensus       111 kE~AIayaek~Gw~Y~V  127 (137)
                      .++|++||+++|+....
T Consensus        44 ~~~~l~~a~~~~~kv~p   60 (78)
T PF14542_consen   44 VEAALDYARENGLKVVP   60 (78)
T ss_dssp             HHHHHHHHHHTT-EEEE
T ss_pred             HHHHHHHHHHCCCEEEE
Confidence            47899999999998653


No 90 
>PF00764 Arginosuc_synth:  Arginosuccinate synthase;  InterPro: IPR001518 Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate [, ]. In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process; PDB: 1K97_A 1KP2_A 1K92_A 1KP3_A 2NZ2_A 1VL2_A 1J1Z_D 1KOR_C 1J20_D 1KH2_C ....
Probab=23.90  E-value=42  Score=29.98  Aligned_cols=18  Identities=33%  Similarity=0.547  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHcCCcEEEe
Q 032597          111 KEAAREFAERHGWEYVVR  128 (137)
Q Consensus       111 kE~AIayaek~Gw~Y~V~  128 (137)
                      +|+.|+||++||++..+.
T Consensus       147 R~~~i~ya~~~gIpv~~~  164 (388)
T PF00764_consen  147 REEEIEYAKKHGIPVPVT  164 (388)
T ss_dssp             HHHHHHHHHHTT----SS
T ss_pred             HHHHHHHHHHcCCCCCCC
Confidence            999999999999987654


No 91 
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport]
Probab=23.62  E-value=60  Score=26.78  Aligned_cols=21  Identities=24%  Similarity=0.377  Sum_probs=17.8

Q ss_pred             eeCCHHHHHHHHHHcCCcEEE
Q 032597          107 SFDSKEAAREFAERHGWEYVV  127 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V  127 (137)
                      +--+.+.|++.|+|.|++|.=
T Consensus       140 R~Vs~~qa~~La~kyglPYfE  160 (219)
T KOG0081|consen  140 RVVSEDQAAALADKYGLPYFE  160 (219)
T ss_pred             hhhhHHHHHHHHHHhCCCeee
Confidence            445789999999999999963


No 92 
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism]
Probab=23.33  E-value=57  Score=29.05  Aligned_cols=20  Identities=40%  Similarity=0.499  Sum_probs=17.0

Q ss_pred             eeeeCCHHHHHHHHHHcCCc
Q 032597          105 GLSFDSKEAAREFAERHGWE  124 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~  124 (137)
                      .+.=.|.|-|++||++|+|.
T Consensus        37 ava~~s~~~A~~fAq~~~~~   56 (351)
T KOG2741|consen   37 AVADPSLERAKEFAQRHNIP   56 (351)
T ss_pred             EEecccHHHHHHHHHhcCCC
Confidence            45556999999999999994


No 93 
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP. Both CK (this CD) and nonhomologous CP synthetase synthesize carbamoyl phosphate, an essential precursor of arginine and pyrimidine bases, in the presence of ATP, bicarbonate, and ammonia. CK is a homodimer of 33 kDa subunits and is a member of the Amino Acid Kinase Superfamily (AAK).
Probab=23.29  E-value=90  Score=26.93  Aligned_cols=23  Identities=35%  Similarity=0.651  Sum_probs=19.2

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEeC
Q 032597          107 SFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .|-|+|+|.+..+++||.|.-+.
T Consensus       130 ~~y~~~~a~~~~~~~g~~~~~d~  152 (308)
T cd04235         130 PFYSEEEAEELAAEKGWTFKEDA  152 (308)
T ss_pred             CCcCHHHHHHHHHHcCCEEEEeC
Confidence            59999999999999999654443


No 94 
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=23.02  E-value=67  Score=22.53  Aligned_cols=22  Identities=18%  Similarity=0.182  Sum_probs=18.7

Q ss_pred             CCHHHHHHHHHHcCCcEEEeCC
Q 032597          109 DSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      ++.|+..+|++++|+.|.+...
T Consensus        71 ~~~~~~~~~~~~~~~~~p~~~D   92 (126)
T cd03012          71 RDLANVKSAVLRYGITYPVAND   92 (126)
T ss_pred             cCHHHHHHHHHHcCCCCCEEEC
Confidence            5789999999999999987653


No 95 
>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion]
Probab=22.82  E-value=77  Score=31.52  Aligned_cols=22  Identities=23%  Similarity=0.418  Sum_probs=19.2

Q ss_pred             eCCHHHHHHHHHHcCCcEEEeC
Q 032597          108 FDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      ..|.|+|++||+++|++..+..
T Consensus       170 itt~~EA~eF~k~yG~PvI~KA  191 (1176)
T KOG0369|consen  170 ITTVEEALEFVKEYGLPVIIKA  191 (1176)
T ss_pred             cccHHHHHHHHHhcCCcEEEee
Confidence            4689999999999999988754


No 96 
>COG2154 Pterin-4a-carbinolamine dehydratase [Coenzyme metabolism]
Probab=22.62  E-value=90  Score=23.04  Aligned_cols=32  Identities=25%  Similarity=0.454  Sum_probs=25.5

Q ss_pred             cCCCcCccCCCC--ccCccCCceeeeCCHHHHHHHHHH
Q 032597           85 ENPLMGWTSTGD--PYANVGDAGLSFDSKEAAREFAER  120 (137)
Q Consensus        85 ~nPLMGWtsS~D--~~sqv~~~~L~F~SkE~AIayaek  120 (137)
                      ...|-||.-..|  -+..    ..+|++-.+|++|..+
T Consensus        15 l~~l~gW~l~~~~~~l~r----~f~FknF~~a~~F~~~   48 (101)
T COG2154          15 LRALPGWELADDGAKLTR----TFKFKNFKQAIAFVNR   48 (101)
T ss_pred             hcCCCCCEEecCcceEEE----EEEcCCHHHHHHHHHH
Confidence            368899999988  3332    7899999999999654


No 97 
>COG5079 SAC3 Nuclear protein export factor [Intracellular trafficking and secretion / Cell division and chromosome partitioning]
Probab=22.47  E-value=47  Score=31.56  Aligned_cols=25  Identities=28%  Similarity=0.432  Sum_probs=22.3

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .|.|+++++++.||+-+|++..+++
T Consensus       356 il~f~~~~e~~efckyy~lei~~ed  380 (646)
T COG5079         356 ILDFEEKGEGEEFCKYYGLEIRIED  380 (646)
T ss_pred             hccccccchhHHHhhhcceeeeccc
Confidence            5899999999999999999887655


No 98 
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones]
Probab=22.39  E-value=47  Score=24.61  Aligned_cols=12  Identities=25%  Similarity=0.598  Sum_probs=10.2

Q ss_pred             HHHHHHcCCcEE
Q 032597          115 REFAERHGWEYV  126 (137)
Q Consensus       115 Iayaek~Gw~Y~  126 (137)
                      -+||+++|+++.
T Consensus        48 ~aYc~r~Gl~~~   59 (99)
T KOG1769|consen   48 KAYCERQGLSMN   59 (99)
T ss_pred             HHHHHHcCCccc
Confidence            589999999864


No 99 
>smart00481 POLIIIAc DNA polymerase alpha chain like domain. DNA polymerase alpha chain like domain, incl. family of hypothetical proteins
Probab=22.34  E-value=1.2e+02  Score=19.06  Aligned_cols=24  Identities=21%  Similarity=0.116  Sum_probs=19.7

Q ss_pred             CCHHHHHHHHHHcCCcEEEeCCCC
Q 032597          109 DSKEAAREFAERHGWEYVVRKPHR  132 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~P~~  132 (137)
                      .+.++.++.|+++|+++.....+.
T Consensus        15 ~~~~~~~~~a~~~g~~~v~iTDh~   38 (67)
T smart00481       15 LSPEELVKRAKELGLKAIAITDHG   38 (67)
T ss_pred             CCHHHHHHHHHHcCCCEEEEeeCC
Confidence            368999999999999988765553


No 100
>PRK06746 peptide chain release factor 2; Provisional
Probab=22.07  E-value=65  Score=28.24  Aligned_cols=16  Identities=19%  Similarity=0.353  Sum_probs=13.7

Q ss_pred             HHHHHHcCCcEEEeCC
Q 032597          115 REFAERHGWEYVVRKP  130 (137)
Q Consensus       115 Iayaek~Gw~Y~V~~P  130 (137)
                      ..||+++||+++|.+-
T Consensus       113 ~r~a~~~g~~~evi~~  128 (326)
T PRK06746        113 TRWAEKRGFKVETVDY  128 (326)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999763


No 101
>cd07202 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent. Group IVC cPLA2, a small 61 kDa protein, is a single domain alpha/beta hydrolase. It lacks a C2 domain; therefore, it has no Ca-dependence. Group IVC cPLA2 is also referred to as cPLA2-gamma. The cPLA2-gamma enzyme is predominantly found in cardiac and skeletal muscles, and to a lesser extent in the brain. Human cPLA2-gamma is approximately 30% identical to cPLA2-alpha. The catalytic domain of cytosolic phospholipase A2 (PLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms. Movement of the cPLA2 lid possibly exposes a greater hydrophobic surface and the active site. cPLA2 be
Probab=21.97  E-value=44  Score=30.43  Aligned_cols=23  Identities=13%  Similarity=0.381  Sum_probs=18.1

Q ss_pred             eCCHHHHHHHHHHcCCcEEEeCC
Q 032597          108 FDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      |.+...|-+||++|||+|-=.+|
T Consensus       321 f~~l~~~~~~c~~~~ipfp~i~~  343 (430)
T cd07202         321 FETIKDTAEYCRKHNIPFPQVDE  343 (430)
T ss_pred             hHHHHHHHHHHHHcCCCCCCcCc
Confidence            45678999999999999854443


No 102
>PF07476 MAAL_C:  Methylaspartate ammonia-lyase C-terminus;  InterPro: IPR022662  Methylaspartate ammonia-lyase 4.3.1.2 from EC catalyses the second step of fermentation of glutamate. It is a homodimer. This domain represents the C-terminal region of methylaspartate ammonia-lyase and contains a TIM barrel fold similar to the PF01188 from PFAM. This domain represents the catalytic domain and contains a metal binding site []. ; PDB: 1KKO_B 1KKR_A 3ZVI_A 1KD0_B 1KCZ_B 3ZVH_A.
Probab=21.81  E-value=72  Score=27.19  Aligned_cols=18  Identities=17%  Similarity=0.202  Sum_probs=13.9

Q ss_pred             CHHHHHHHHHHcCCcEEE
Q 032597          110 SKEAAREFAERHGWEYVV  127 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~V  127 (137)
                      +-=+||-||+++|..-++
T Consensus       177 ntieAvlyCk~~gvgaY~  194 (248)
T PF07476_consen  177 NTIEAVLYCKEHGVGAYL  194 (248)
T ss_dssp             HHHHHHHHHHHTT-EEEE
T ss_pred             hHHHHHHHHHhcCCceee
Confidence            346899999999998765


No 103
>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed
Probab=21.65  E-value=1.2e+02  Score=21.64  Aligned_cols=25  Identities=12%  Similarity=0.053  Sum_probs=21.0

Q ss_pred             eeeCCHHHHHHHHHHcCCcEEEeCC
Q 032597          106 LSFDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       106 L~F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      +..++.+++++-|.++|..-.+.-|
T Consensus        43 ~~~P~l~~~l~~l~~~g~~~v~vvP   67 (126)
T PRK00923         43 FNEPTIPEALKKLIGTGADKIIVVP   67 (126)
T ss_pred             cCCCCHHHHHHHHHHcCCCEEEEEc
Confidence            3468999999999999998777655


No 104
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Probab=21.64  E-value=68  Score=23.43  Aligned_cols=21  Identities=29%  Similarity=0.352  Sum_probs=17.9

Q ss_pred             eCCHHHHHHHHHH-cCCcEEEe
Q 032597          108 FDSKEAAREFAER-HGWEYVVR  128 (137)
Q Consensus       108 F~SkE~AIayaek-~Gw~Y~V~  128 (137)
                      .++.|+..+|+++ +|+.|.+.
T Consensus        71 ~d~~~~~~~f~~~~~~~~fp~~   92 (153)
T TIGR02540        71 PDSSKEIESFARRNYGVTFPMF   92 (153)
T ss_pred             CCCHHHHHHHHHHhcCCCCCcc
Confidence            3778999999986 89999874


No 105
>TIGR01004 PulS_OutS lipoprotein, PulS/OutS family. This family comprises lipoproteins from four gamma proteobacterial species: PulS protein of Klebsiella pneumoniae, the OutS protein of Erwinia chrysanthemi and Pectobacterium chrysanthemi, and the functionally uncharacterized E. coli protein EtpO. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.
Probab=21.46  E-value=62  Score=25.00  Aligned_cols=13  Identities=31%  Similarity=0.647  Sum_probs=11.4

Q ss_pred             HHHHHHHHcCCcE
Q 032597          113 AAREFAERHGWEY  125 (137)
Q Consensus       113 ~AIayaek~Gw~Y  125 (137)
                      .||.||+.+||+-
T Consensus        70 aai~~A~~~gWd~   82 (128)
T TIGR01004        70 TANNVAIGKGWDS   82 (128)
T ss_pred             HHHHHHHHcCCch
Confidence            7999999999963


No 106
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed
Probab=21.42  E-value=1.3e+02  Score=25.55  Aligned_cols=27  Identities=7%  Similarity=-0.041  Sum_probs=23.5

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeCCC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRKPH  131 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~P~  131 (137)
                      .+-..++++|.++|+++|++|.+...+
T Consensus       124 ~~visn~~~~~~~A~~~gIp~~~~~~~  150 (289)
T PRK13010        124 VGIISNHPDLQPLAVQHDIPFHHLPVT  150 (289)
T ss_pred             EEEEECChhHHHHHHHcCCCEEEeCCC
Confidence            788899999999999999999985533


No 107
>PF10686 DUF2493:  Protein of unknown function (DUF2493);  InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family are mainly Proteobacteria. The function is not known. 
Probab=21.41  E-value=1e+02  Score=20.82  Aligned_cols=19  Identities=16%  Similarity=0.163  Sum_probs=16.0

Q ss_pred             HHHHHHHHcCCcEEEeCCC
Q 032597          113 AAREFAERHGWEYVVRKPH  131 (137)
Q Consensus       113 ~AIayaek~Gw~Y~V~~P~  131 (137)
                      -|..||+++|+..++-.|.
T Consensus        48 iA~~wA~~~gv~~~~~~ad   66 (71)
T PF10686_consen   48 IAARWARERGVPVIRFPAD   66 (71)
T ss_pred             HHHHHHHHCCCeeEEeCcC
Confidence            4778999999999887765


No 108
>PRK13820 argininosuccinate synthase; Provisional
Probab=21.37  E-value=70  Score=28.51  Aligned_cols=19  Identities=26%  Similarity=0.333  Sum_probs=17.2

Q ss_pred             CHHHHHHHHHHcCCcEEEe
Q 032597          110 SKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~V~  128 (137)
                      ||++-++||+++|++|...
T Consensus       148 tK~ei~~ya~~~gip~~~~  166 (394)
T PRK13820        148 TREWEIEYAKEKGIPVPVG  166 (394)
T ss_pred             CHHHHHHHHHHcCCCCCcC
Confidence            9999999999999999653


No 109
>PF04895 DUF651:  Archaeal protein of unknown function (DUF651);  InterPro: IPR006979 This conserved region is found in the C-terminal region of a number of conserved archaeal proteins of unknown function.
Probab=21.21  E-value=66  Score=24.01  Aligned_cols=17  Identities=24%  Similarity=0.354  Sum_probs=14.9

Q ss_pred             eeeeCCHHHHHHHHHHc
Q 032597          105 GLSFDSKEAAREFAERH  121 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~  121 (137)
                      -..|+|.++|+.|+...
T Consensus        67 p~~f~~l~eAl~~~~~~   83 (110)
T PF04895_consen   67 PEKFETLEEALEYVSSR   83 (110)
T ss_pred             CcccCCHHHHHHHHHHH
Confidence            57999999999999864


No 110
>PRK00509 argininosuccinate synthase; Provisional
Probab=21.16  E-value=67  Score=28.69  Aligned_cols=21  Identities=33%  Similarity=0.487  Sum_probs=17.8

Q ss_pred             eeCCHHHHHHHHHHcCCcEEE
Q 032597          107 SFDSKEAAREFAERHGWEYVV  127 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V  127 (137)
                      .|.||++-++||+++|++...
T Consensus       148 ~~~tK~eir~~A~~~Gipv~~  168 (399)
T PRK00509        148 DLKSREELIAYAEEHGIPIPV  168 (399)
T ss_pred             CCCCHHHHHHHHHHcCCCCCC
Confidence            355999999999999998653


No 111
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain. Bsu1 encodes a nuclear serine-threonine protein phosphatase found in plants and protozoans.  Bsu1 has a C-terminal phosphatase domain and an N-terminal Kelch-repeat domain.  Bsu1 is preferentially expressed in elongating plant cells. It modulates the phosphorylation state of Bes1, a transcriptional regulator phosphorylated by the glycogen synthase kinase Bin2, as part of a steroid hormone signal transduction pathway.  The PPP (phosphoprotein phosphatase) family, to which Bsu1 belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most
Probab=21.14  E-value=1.8e+02  Score=24.69  Aligned_cols=23  Identities=13%  Similarity=0.242  Sum_probs=19.0

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEeC
Q 032597          107 SFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .+=..+++-+||+++|+++.|.-
T Consensus       238 ~~fg~~~~~~Fl~~n~l~~iiRg  260 (311)
T cd07419         238 VKFGPDRVHRFLEENDLQMIIRA  260 (311)
T ss_pred             eeECHHHHHHHHHHCCCeEEEEe
Confidence            34467888999999999998864


No 112
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain. Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs.  The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cel
Probab=20.97  E-value=2e+02  Score=24.70  Aligned_cols=24  Identities=29%  Similarity=0.718  Sum_probs=19.8

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEEEeC
Q 032597          105 GLSFDSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      ...| ..++..+||++||+++.|.-
T Consensus       228 g~~f-g~~~~~~Fl~~n~l~~iiR~  251 (316)
T cd07417         228 GCQF-GPDVTKRFLEENNLEYIIRS  251 (316)
T ss_pred             ceEe-CHHHHHHHHHHcCCcEEEEC
Confidence            5567 67777899999999998864


No 113
>PRK12686 carbamate kinase; Reviewed
Probab=20.95  E-value=71  Score=27.64  Aligned_cols=22  Identities=27%  Similarity=0.394  Sum_probs=18.4

Q ss_pred             eeCCHHHHHHHHHHcCCcEEEe
Q 032597          107 SFDSKEAAREFAERHGWEYVVR  128 (137)
Q Consensus       107 ~F~SkE~AIayaek~Gw~Y~V~  128 (137)
                      .|-|+|+|-..|+++||.|.-+
T Consensus       132 ~~~~~~~a~~~~~~~g~~~~~d  153 (312)
T PRK12686        132 PFYTEEEAKQQAEQPGSTFKED  153 (312)
T ss_pred             CccCHHHHHHHHHHcCCccccc
Confidence            5999999999999999955443


No 114
>cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs). CLECT_NK_receptors_like: C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs), including proteins similar to oxidized low density lipoprotein (OxLDL) receptor (LOX-1), CD94, CD69, NKG2-A and -D, osteoclast inhibitory lectin (OCIL), dendritic cell-associated C-type lectin-1 (dectin-1),  human myeloid inhibitory C-type lectin-like receptor (MICL), mast cell-associated functional antigen (MAFA), killer cell lectin-like receptors: subfamily F, member 1 (KLRF1) and subfamily B, member 1 (KLRB1), and lys49 receptors.  CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins.  NKRs are variously associated with activation or inhibition of natural killer (NK) cells. Activating NKRs stimulate cytolysis by NK cells of virally infected or transformed cells; inhibitory NKRs block cytolysis up
Probab=20.72  E-value=70  Score=21.60  Aligned_cols=19  Identities=5%  Similarity=0.055  Sum_probs=14.7

Q ss_pred             CCHHHHHHHHHHcCCcEEE
Q 032597          109 DSKEAAREFAERHGWEYVV  127 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V  127 (137)
                      .|=++|..+|+++|=...+
T Consensus        20 ~~w~~A~~~C~~~g~~La~   38 (116)
T cd03593          20 KTWNESKEACSSKNSSLLK   38 (116)
T ss_pred             CCHHHHHHHHHhCCCcEEE
Confidence            4678999999999865443


No 115
>PF01910 DUF77:  Domain of unknown function DUF77;  InterPro: IPR002767 This entry contains several hypothetical proteins of unknown function found in archaebacteria, eukaryotes and eubacteria. The structures of YBL001c from Saccharomyces cerevisiae and its homologue MTH1187 from the archaea Methanobacterium thermoautotrophicum have been determined []. These proteins have a ferredoxin-like alpha/beta sandwich structure with anti-parallel beta-sheets. Generally, they have two domains that form a single beta-sheet dimer, where two dimers pack sheet-to-sheet into a tetramer, some proteins having an extra C-terminal helix. ; PDB: 1LXJ_A 1YQH_A 2EKY_G 2EPI_A 1VK8_D 2IBO_C 1LXN_B.
Probab=20.49  E-value=87  Score=22.14  Aligned_cols=19  Identities=26%  Similarity=0.307  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHcCCcEEEeC
Q 032597          111 KEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       111 kE~AIayaek~Gw~Y~V~~  129 (137)
                      -.+||++-++.|++|+|-.
T Consensus        19 V~~~i~~i~~sgl~y~v~p   37 (92)
T PF01910_consen   19 VAEAIEVIKESGLKYEVGP   37 (92)
T ss_dssp             HHHHHHHHHTSSSEEEEET
T ss_pred             HHHHHHHHHHcCCceEEcC
Confidence            3689999999999999853


No 116
>PF14555 UBA_4:  UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A.
Probab=20.31  E-value=99  Score=18.55  Aligned_cols=17  Identities=18%  Similarity=0.583  Sum_probs=14.1

Q ss_pred             CHHHHHHHHHHcCCcEE
Q 032597          110 SKEAAREFAERHGWEYV  126 (137)
Q Consensus       110 SkE~AIayaek~Gw~Y~  126 (137)
                      +.+.|+.|-++++|+.+
T Consensus        14 ~~~~A~~~L~~~~wdle   30 (43)
T PF14555_consen   14 DEDVAIQYLEANNWDLE   30 (43)
T ss_dssp             SHHHHHHHHHHTTT-HH
T ss_pred             CHHHHHHHHHHcCCCHH
Confidence            67999999999999853


No 117
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only]
Probab=20.27  E-value=53  Score=28.25  Aligned_cols=68  Identities=29%  Similarity=0.412  Sum_probs=46.8

Q ss_pred             ccccCCCcccccceEEEecCCCCCCCCCCCCCCCcEEEccCCCCccCCCcCccCCCC----ccCccCCceeeeCCHHHHH
Q 032597           40 GMVSGIPEEHLRRRVVIYTPARTATQQGSGKLGRWKINFMSTQKWENPLMGWTSTGD----PYANVGDAGLSFDSKEAAR  115 (137)
Q Consensus        40 ~~vSG~P~e~~~R~vrIY~Pak~amQSG~~~~~~W~LeFe~~~rw~nPLMGWtsS~D----~~sqv~~~~L~F~SkE~AI  115 (137)
                      -.|||+|+|.-+|-  ||-                  =|-.-.-+|-.|.-.||-+|    |..     -..|.|..+|+
T Consensus        37 LFVSGLP~DvKpRE--iyn------------------LFR~f~GYEgslLK~Tsk~~~~~~pva-----FatF~s~q~A~   91 (284)
T KOG1457|consen   37 LFVSGLPNDVKPRE--IYN------------------LFRRFHGYEGSLLKYTSKGDQVCKPVA-----FATFTSHQFAL   91 (284)
T ss_pred             eeeccCCcccCHHH--HHH------------------HhccCCCccceeeeeccCCCccccceE-----EEEecchHHHH
Confidence            47999999977663  332                  12223456777888888888    443     56899999998


Q ss_pred             HHHH-HcCCcEEEeCCCC
Q 032597          116 EFAE-RHGWEYVVRKPHR  132 (137)
Q Consensus       116 ayae-k~Gw~Y~V~~P~~  132 (137)
                      +--. =||+.|+-+.+..
T Consensus        92 aamnaLNGvrFDpE~~st  109 (284)
T KOG1457|consen   92 AAMNALNGVRFDPETGST  109 (284)
T ss_pred             HHHHHhcCeeeccccCce
Confidence            7543 4788887666543


No 118
>PF00331 Glyco_hydro_10:  Glycosyl hydrolase family 10;  InterPro: IPR001000 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 10 GH10 from CAZY comprises enzymes with a number of known activities; xylanase (3.2.1.8 from EC); endo-1,3-beta-xylanase (3.2.1.32 from EC); cellobiohydrolase (3.2.1.91 from EC). These enzymes were formerly known as cellulase family F.  The microbial degradation of cellulose and xylans requires several types of enzymes such as endoglucanases (3.2.1.4 from EC), cellobiohydrolases (3.2.1.91 from EC) (exoglucanases), or xylanases (3.2.1.8 from EC) [, ]. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family F [] or as the glycosyl hydrolases family 10 []. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1UQZ_A 1UQY_A 1UR2_A 1UR1_A 2CNC_A 1OD8_A 1E0W_A 1E0V_A 1V0M_A 1E0X_B ....
Probab=20.26  E-value=66  Score=27.15  Aligned_cols=22  Identities=23%  Similarity=0.442  Sum_probs=18.2

Q ss_pred             eeeeCCHHHHHHHHHHcCCcEE
Q 032597          105 GLSFDSKEAAREFAERHGWEYV  126 (137)
Q Consensus       105 ~L~F~SkE~AIayaek~Gw~Y~  126 (137)
                      +..|+..++.++||+++|+...
T Consensus        55 ~~~~~~~D~~~~~a~~~g~~vr   76 (320)
T PF00331_consen   55 RFNFESADAILDWARENGIKVR   76 (320)
T ss_dssp             BEE-HHHHHHHHHHHHTT-EEE
T ss_pred             ccCccchhHHHHHHHhcCccee
Confidence            5799999999999999999875


No 119
>cd00488 PCD_DCoH PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein). Two DCoH proteins have been identifed in humans: DCoH1 and DCoH2. Mutations in human DCoH1 cause hyperphenylalaninemia. Loss of enzymic activity of DCoH in humans is associated with the depigmentation disorder vitiligo. DCoH1 has been reported to be overexpessed in colon cancer carc
Probab=20.19  E-value=1.3e+02  Score=20.06  Aligned_cols=16  Identities=25%  Similarity=0.409  Sum_probs=14.2

Q ss_pred             eeeeCCHHHHHHHHHH
Q 032597          105 GLSFDSKEAAREFAER  120 (137)
Q Consensus       105 ~L~F~SkE~AIayaek  120 (137)
                      ..+|++-.+|++|+.+
T Consensus        13 ~f~f~~f~~a~~f~~~   28 (75)
T cd00488          13 TFKFKDFKEAIAFVNR   28 (75)
T ss_pred             EEEcCCHHHHHHHHHH
Confidence            7889999999999765


No 120
>PLN02626 malate synthase
Probab=20.13  E-value=44  Score=31.39  Aligned_cols=47  Identities=28%  Similarity=0.491  Sum_probs=37.0

Q ss_pred             cccCCCcccccceEEEecCCC-----CCCCCCCCCCCCcEEEccCC--CCccCCCcC
Q 032597           41 MVSGIPEEHLRRRVVIYTPAR-----TATQQGSGKLGRWKINFMST--QKWENPLMG   90 (137)
Q Consensus        41 ~vSG~P~e~~~R~vrIY~Pak-----~amQSG~~~~~~W~LeFe~~--~rw~nPLMG   90 (137)
                      -|..+|.++..|+|-|--|..     ||+.||-   +.|..|||..  +.|.|-+-|
T Consensus        80 ~va~~p~~L~dRrvEItgP~drkm~inalNSga---~~~maDfEDs~sPtW~n~i~G  133 (551)
T PLN02626         80 RCAPVPPAVADRRVEITGPVERKMVINALNSGA---KVFMADFEDSLSPTWENLMRG  133 (551)
T ss_pred             eeCCCChhhccceeeecCCCcHHHHHHHHcCCC---CEEEecCCccCCCcchhHHHH
Confidence            578899999999999987763     6777763   5799999975  688776655


No 121
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=20.11  E-value=1.4e+02  Score=19.19  Aligned_cols=23  Identities=9%  Similarity=-0.038  Sum_probs=18.9

Q ss_pred             eCCHHHHHHHHHHcCCcEEEeCC
Q 032597          108 FDSKEAAREFAERHGWEYVVRKP  130 (137)
Q Consensus       108 F~SkE~AIayaek~Gw~Y~V~~P  130 (137)
                      =.+...-+.||++.|+.|.|.--
T Consensus        37 ~~~~~~~~~~a~~~g~~~~iiig   59 (91)
T cd00860          37 NEKLGKKIREAQLQKIPYILVVG   59 (91)
T ss_pred             CCCHHHHHHHHHHcCCCEEEEEC
Confidence            35778899999999999887654


No 122
>cd06575 PASTA_Pbp2x-like_2 PASTA domain of PBP2x-like proteins, second repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are attached to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=20.08  E-value=1.5e+02  Score=16.87  Aligned_cols=21  Identities=24%  Similarity=0.083  Sum_probs=17.8

Q ss_pred             CCHHHHHHHHHHcCCcEEEeC
Q 032597          109 DSKEAAREFAERHGWEYVVRK  129 (137)
Q Consensus       109 ~SkE~AIayaek~Gw~Y~V~~  129 (137)
                      .+.++|.+..++.|+.+.+..
T Consensus         8 ~~~~~a~~~l~~~g~~~~~~~   28 (54)
T cd06575           8 WSKRDALKLLELLGLKVKFSG   28 (54)
T ss_pred             CCHHHHHHHHHHCCCeEEEee
Confidence            578999999999999987653


Done!