BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032610
(137 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
Lanuginosus At 3.1 Angstrom Resolution. This File
Contains The Beta Subunits Of The Fatty Acid Synthase.
The Entire Crystal Structure Consists Of One
Heterododecameric Fatty Acid Synthase And Is Described In
Remark 400
pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
Resolution. This File Contains The Beta Subunits Of The
Fatty Acid Synthase. The Entire Crystal Structure
Consists Of One Heterododecameric Fatty Acid Synthase And
Is Described In Remark 400
Length = 2060
Score = 28.1 bits (61), Expect = 1.4, Method: Composition-based stats.
Identities = 13/32 (40%), Positives = 18/32 (56%)
Query: 1 MDIISQLQEQINQIAGIAFNTFGTLQRDAPPV 32
+D +Q+ INQ +G GTL+RD PV
Sbjct: 1377 LDTTAQINAVINQDSGKMVEVCGTLKRDGKPV 1408
>pdb|3DXR|B Chain B, Crystal Structure Of The Yeast Inter-Membrane Space
Chaperone Assembly Tim9.10
Length = 95
Score = 25.8 bits (55), Expect = 7.8, Method: Compositional matrix adjust.
Identities = 10/26 (38%), Positives = 19/26 (73%)
Query: 106 QRQLEAAEKELKQVQELFSQAADNCL 131
Q++++AAE EL V ++F++ +NC
Sbjct: 18 QQKIQAAEAELDLVTDMFNKLVNNCY 43
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.127 0.345
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,155,632
Number of Sequences: 62578
Number of extensions: 90913
Number of successful extensions: 222
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 213
Number of HSP's gapped (non-prelim): 12
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)