BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032610
         (137 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2UVA|G Chain G, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|H Chain H, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|I Chain I, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|J Chain J, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|K Chain K, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVA|L Chain L, Crystal Structure Of Fatty Acid Synthase From Thermomyces
            Lanuginosus At 3.1 Angstrom Resolution. This File
            Contains The Beta Subunits Of The Fatty Acid Synthase.
            The Entire Crystal Structure Consists Of One
            Heterododecameric Fatty Acid Synthase And Is Described In
            Remark 400
 pdb|2UVC|G Chain G, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|H Chain H, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|I Chain I, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|J Chain J, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|K Chain K, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
 pdb|2UVC|L Chain L, Crystal Structure Of Fatty Acid Synthase Complexed With
            Nadp+ From Thermomyces Lanuginosus At 3.1 Angstrom
            Resolution. This File Contains The Beta Subunits Of The
            Fatty Acid Synthase. The Entire Crystal Structure
            Consists Of One Heterododecameric Fatty Acid Synthase And
            Is Described In Remark 400
          Length = 2060

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 1    MDIISQLQEQINQIAGIAFNTFGTLQRDAPPV 32
            +D  +Q+   INQ +G      GTL+RD  PV
Sbjct: 1377 LDTTAQINAVINQDSGKMVEVCGTLKRDGKPV 1408


>pdb|3DXR|B Chain B, Crystal Structure Of The Yeast Inter-Membrane Space
           Chaperone Assembly Tim9.10
          Length = 95

 Score = 25.8 bits (55), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 10/26 (38%), Positives = 19/26 (73%)

Query: 106 QRQLEAAEKELKQVQELFSQAADNCL 131
           Q++++AAE EL  V ++F++  +NC 
Sbjct: 18  QQKIQAAEAELDLVTDMFNKLVNNCY 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.312    0.127    0.345 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,155,632
Number of Sequences: 62578
Number of extensions: 90913
Number of successful extensions: 222
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 213
Number of HSP's gapped (non-prelim): 12
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 46 (22.3 bits)