BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032614
         (137 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1HCU|A Chain A, Alpha-1,2-Mannosidase From Trichoderma Reesei
 pdb|1HCU|B Chain B, Alpha-1,2-Mannosidase From Trichoderma Reesei
 pdb|1HCU|C Chain C, Alpha-1,2-Mannosidase From Trichoderma Reesei
 pdb|1HCU|D Chain D, Alpha-1,2-Mannosidase From Trichoderma Reesei
          Length = 503

 Score = 27.7 bits (60), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 76  WFPLYHHVKFAFLVW-----LQLPSTNGAKYFYMSRLRPFLLRHQAR 117
           WF     +K+A+L++     +Q+ +T G K+ + +   PF +R  +R
Sbjct: 453 WFA--EALKYAYLIFAEESDVQVQATGGNKFVFNTEAHPFSIRSSSR 497


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.455 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,076,940
Number of Sequences: 62578
Number of extensions: 151647
Number of successful extensions: 364
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 364
Number of HSP's gapped (non-prelim): 1
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 46 (22.3 bits)