BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032614
(137 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1HCU|A Chain A, Alpha-1,2-Mannosidase From Trichoderma Reesei
pdb|1HCU|B Chain B, Alpha-1,2-Mannosidase From Trichoderma Reesei
pdb|1HCU|C Chain C, Alpha-1,2-Mannosidase From Trichoderma Reesei
pdb|1HCU|D Chain D, Alpha-1,2-Mannosidase From Trichoderma Reesei
Length = 503
Score = 27.7 bits (60), Expect = 1.9, Method: Composition-based stats.
Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 7/47 (14%)
Query: 76 WFPLYHHVKFAFLVW-----LQLPSTNGAKYFYMSRLRPFLLRHQAR 117
WF +K+A+L++ +Q+ +T G K+ + + PF +R +R
Sbjct: 453 WFA--EALKYAYLIFAEESDVQVQATGGNKFVFNTEAHPFSIRSSSR 497
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.140 0.455
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,076,940
Number of Sequences: 62578
Number of extensions: 151647
Number of successful extensions: 364
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 364
Number of HSP's gapped (non-prelim): 1
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 46 (22.3 bits)