BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032615
         (137 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3VAB|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From
           Brucella Melitensis Bound To Plp
 pdb|3VAB|B Chain B, Crystal Structure Of Diaminopimelate Decarboxylase From
           Brucella Melitensis Bound To Plp
          Length = 443

 Score = 26.6 bits (57), Expect = 4.8,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 11  NSPLLIFPKFNDNRKFHLNRTRNFGQRIGALSSVEEFL 48
           NS LLI     D  ++H+ R R   + + AL SV ++L
Sbjct: 406 NSRLLIPEVLGDGERYHVVRPRRTYEELLALDSVPDWL 443


>pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
           Synthase Ii From Bartonella Henselae
 pdb|3E60|B Chain B, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
           Synthase Ii From Bartonella Henselae
          Length = 424

 Score = 26.2 bits (56), Expect = 5.3,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 85  VRPLTVLKLRGEKLELQLLEIAQREVILGSYEPQLNLLSKK 125
           V  L  +   G      ++E+A  E +LG Y PQ+++ S K
Sbjct: 306 VSELDYINAHGTSTMADVIELAAVERVLGYYAPQVSMSSTK 346


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.141    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,983,751
Number of Sequences: 62578
Number of extensions: 145462
Number of successful extensions: 193
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 191
Number of HSP's gapped (non-prelim): 2
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)