BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 032615
(137 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3VAB|A Chain A, Crystal Structure Of Diaminopimelate Decarboxylase From
Brucella Melitensis Bound To Plp
pdb|3VAB|B Chain B, Crystal Structure Of Diaminopimelate Decarboxylase From
Brucella Melitensis Bound To Plp
Length = 443
Score = 26.6 bits (57), Expect = 4.8, Method: Composition-based stats.
Identities = 14/38 (36%), Positives = 21/38 (55%)
Query: 11 NSPLLIFPKFNDNRKFHLNRTRNFGQRIGALSSVEEFL 48
NS LLI D ++H+ R R + + AL SV ++L
Sbjct: 406 NSRLLIPEVLGDGERYHVVRPRRTYEELLALDSVPDWL 443
>pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
Synthase Ii From Bartonella Henselae
pdb|3E60|B Chain B, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein)
Synthase Ii From Bartonella Henselae
Length = 424
Score = 26.2 bits (56), Expect = 5.3, Method: Composition-based stats.
Identities = 13/41 (31%), Positives = 21/41 (51%)
Query: 85 VRPLTVLKLRGEKLELQLLEIAQREVILGSYEPQLNLLSKK 125
V L + G ++E+A E +LG Y PQ+++ S K
Sbjct: 306 VSELDYINAHGTSTMADVIELAAVERVLGYYAPQVSMSSTK 346
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.141 0.429
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,983,751
Number of Sequences: 62578
Number of extensions: 145462
Number of successful extensions: 193
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 191
Number of HSP's gapped (non-prelim): 2
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)