BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 032628
         (137 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1QZ4|A Chain A, Structure Of Ycfc Protein Of Unknown Function Escherichia
           Coli
 pdb|1SDI|A Chain A, 1.65 A Structure Of Escherichia Coli Ycfc Gene Product
          Length = 213

 Score = 26.9 bits (58), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 19/35 (54%)

Query: 65  RVQAAKIPSGVDLPRVQPKFQAPFLGFTKTAEIWN 99
           R+Q    P+ +  P+VQ K +A  L   + A +W+
Sbjct: 148 RIQVTGSPAVLQSPQVQAKVRATLLAGIRAAVLWH 182


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,088,437
Number of Sequences: 62578
Number of extensions: 103199
Number of successful extensions: 138
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 137
Number of HSP's gapped (non-prelim): 1
length of query: 137
length of database: 14,973,337
effective HSP length: 89
effective length of query: 48
effective length of database: 9,403,895
effective search space: 451386960
effective search space used: 451386960
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 46 (22.3 bits)