Citrus Sinensis ID: 032630


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MDIISQLQEQINQIAGIAFNTFGTLQRDAPPVRLSPNYPEPPANPTEDAANFAEQPKLMSAALVKAAKQFDALVAALPLAEGGEEAQLKRIAELQSENDAVGQDLQRQLEAAEKELKQVQELFSQAADNCLNLKKPN
ccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
MDIISQLQEQINQIAGIAFNTFGTLQRDA**************************PKLMSAALVKAAKQFDALVAALPL******************************EAAEKELKQVQELFSQAADN*L******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIISQLQEQINQIAGIAFNTFGTLQRDAPPVRLSPNYPEPPANPTEDAANFAEQPKLMSAALVKAAKQFDALVAALPLAEGGEEAQLKRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCLNLKKPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 21 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for embryo development and defense against necrotrophic fungal pathogens.confidentC0LU16

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YKE, chain B
Confidence level:very confident
Coverage over the Query: 2-36,47-130
View the alignment between query and template
View the model in PyMOL