Citrus Sinensis ID: 032633


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------
MAASVMASSLSLKPAPFTVEKSAARGLPSLAKTSFKIVAKGGKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVYNTSALAQ
ccHHHHHHccccccccccHcccccccccccccccEEEEECccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccEEccccHHHHHHHHHHHHHHHHcEEEEEEcccccc
*********************************SFKIVAKGGKIK****YGV******************GKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVYNTSAL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASVMASSLSLKPAPFTVEKSAARGLPSLAKTSFKIVAKGGKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTLAGLLAGGALLVYNTSALAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem II 10 kDa polypeptide, chloroplastic Associated with the oxygen-evolving complex of photosystem II.confidentP27202
Photosystem II 10 kDa polypeptide, chloroplastic Associated with the oxygen-evolving complex of photosystem II.probableQ40519
Photosystem II 10 kDa polypeptide, chloroplastic Associated with the oxygen-evolving complex of photosystem II.probableP10690

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted