Citrus Sinensis ID: 032642
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 388522207 | 134 | unknown [Medicago truncatula] | 0.985 | 1.0 | 0.904 | 8e-62 | |
| 351734436 | 136 | uncharacterized protein LOC100306323 [Gl | 1.0 | 1.0 | 0.948 | 7e-61 | |
| 224062285 | 137 | histone 2 [Populus trichocarpa] gi|11848 | 1.0 | 0.992 | 0.948 | 9e-61 | |
| 388506528 | 135 | unknown [Lotus japonicus] | 0.992 | 1.0 | 0.897 | 1e-60 | |
| 226532207 | 138 | uncharacterized protein LOC100273753 [Ze | 1.0 | 0.985 | 0.884 | 1e-60 | |
| 449455262 | 136 | PREDICTED: histone H2A variant 1-like is | 1.0 | 1.0 | 0.941 | 3e-60 | |
| 224085557 | 139 | histone 2 [Populus trichocarpa] gi|11848 | 1.0 | 0.978 | 0.928 | 1e-59 | |
| 15232536 | 136 | histone H2A [Arabidopsis thaliana] gi|29 | 1.0 | 1.0 | 0.919 | 2e-59 | |
| 356504967 | 136 | PREDICTED: histone H2A variant 1-like [G | 1.0 | 1.0 | 0.911 | 7e-59 | |
| 15224957 | 136 | histone H2A 8 [Arabidopsis thaliana] gi| | 1.0 | 1.0 | 0.889 | 5e-58 |
| >gi|388522207|gb|AFK49165.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Score = 241 bits (614), Expect = 8e-62, Method: Compositional matrix adjust.
Identities = 123/136 (90%), Positives = 127/136 (93%), Gaps = 2/136 (1%)
Query: 1 MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGA 60
MAGKGGKGL+AAKTTA NKDKDK KRP SRSSRAGIQFPVGRIHR LK R+ A+GRVGA
Sbjct: 1 MAGKGGKGLVAAKTTAANKDKDK--KRPTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGA 58
Query: 61 TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTL KGTIAGGG
Sbjct: 59 TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLTKGTIAGGG 118
Query: 121 VIPHIHKSLINKTTKD 136
VIPHIHKSLINKT K+
Sbjct: 119 VIPHIHKSLINKTAKE 134
|
Source: Medicago truncatula Species: Medicago truncatula Genus: Medicago Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|351734436|ref|NP_001237025.1| uncharacterized protein LOC100306323 [Glycine max] gi|356500154|ref|XP_003518898.1| PREDICTED: histone H2A variant 1-like [Glycine max] gi|255628201|gb|ACU14445.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224062285|ref|XP_002300810.1| histone 2 [Populus trichocarpa] gi|118482024|gb|ABK92943.1| unknown [Populus trichocarpa] gi|222842536|gb|EEE80083.1| histone 2 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|388506528|gb|AFK41330.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|226532207|ref|NP_001141633.1| uncharacterized protein LOC100273753 [Zea mays] gi|242065684|ref|XP_002454131.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor] gi|194705342|gb|ACF86755.1| unknown [Zea mays] gi|195605334|gb|ACG24497.1| histone H2A variant 1 [Zea mays] gi|195605602|gb|ACG24631.1| histone H2A variant 1 [Zea mays] gi|195624562|gb|ACG34111.1| histone H2A variant 1 [Zea mays] gi|241933962|gb|EES07107.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor] gi|414864935|tpg|DAA43492.1| TPA: histone H2A [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|449455262|ref|XP_004145372.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449455264|ref|XP_004145373.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449470505|ref|XP_004152957.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449470507|ref|XP_004152958.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449509347|ref|XP_004163562.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449509351|ref|XP_004163563.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224085557|ref|XP_002307619.1| histone 2 [Populus trichocarpa] gi|118486969|gb|ABK95317.1| unknown [Populus trichocarpa] gi|222857068|gb|EEE94615.1| histone 2 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15232536|ref|NP_191019.1| histone H2A [Arabidopsis thaliana] gi|297816752|ref|XP_002876259.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata] gi|75277395|sp|O23628.1|H2AV1_ARATH RecName: Full=Histone H2A variant 1; AltName: Full=H2A.F/Z 1; AltName: Full=H2AvAt; AltName: Full=HTA11 gi|2407800|emb|CAA73155.1| histone H2A.F/Z [Arabidopsis thaliana] gi|7258359|emb|CAB77576.1| histone H2A.F/Z [Arabidopsis thaliana] gi|21592838|gb|AAM64788.1| histone H2A.F/Z [Arabidopsis thaliana] gi|28950691|gb|AAO63269.1| At3g54560 [Arabidopsis thaliana] gi|110736078|dbj|BAF00012.1| histone H2A.F/Z [Arabidopsis thaliana] gi|297322097|gb|EFH52518.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata] gi|332645729|gb|AEE79250.1| histone H2A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356504967|ref|XP_003521264.1| PREDICTED: histone H2A variant 1-like [Glycine max] gi|356572232|ref|XP_003554274.1| PREDICTED: histone H2A variant 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15224957|ref|NP_181415.1| histone H2A 8 [Arabidopsis thaliana] gi|30687643|ref|NP_850298.1| histone H2A 8 [Arabidopsis thaliana] gi|30687646|ref|NP_850299.1| histone H2A 8 [Arabidopsis thaliana] gi|75313476|sp|Q9SII0.1|H2AV2_ARATH RecName: Full=Probable histone H2A variant 2; AltName: Full=H2A.F/Z 2; AltName: Full=HTA8 gi|4585900|gb|AAD25562.1| histone H2A [Arabidopsis thaliana] gi|21595470|gb|AAM66104.1| histone H2A [Arabidopsis thaliana] gi|62319094|dbj|BAD94243.1| histone H2A [Arabidopsis thaliana] gi|110736503|dbj|BAF00219.1| histone H2A [Arabidopsis thaliana] gi|111074314|gb|ABH04530.1| At2g38810 [Arabidopsis thaliana] gi|330254492|gb|AEC09586.1| histone H2A 8 [Arabidopsis thaliana] gi|330254493|gb|AEC09587.1| histone H2A 8 [Arabidopsis thaliana] gi|330254494|gb|AEC09588.1| histone H2A 8 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TAIR|locus:2096951 | 136 | HTA11 "histone H2A 11" [Arabid | 0.875 | 0.875 | 0.932 | 6.1e-55 | |
| TAIR|locus:2040384 | 136 | HTA8 "histone H2A 8" [Arabidop | 0.860 | 0.860 | 0.897 | 6.5e-51 | |
| TAIR|locus:2011456 | 134 | HTA9 "histone H2A protein 9" [ | 0.860 | 0.873 | 0.880 | 8.3e-51 | |
| FB|FBgn0001197 | 141 | His2Av "Histone H2A variant" [ | 0.838 | 0.808 | 0.850 | 8.8e-47 | |
| UNIPROTKB|F2Z4M5 | 127 | H2AFZ "Histone H2A" [Gallus ga | 0.838 | 0.897 | 0.850 | 8.8e-47 | |
| UNIPROTKB|Q5ZMD6 | 128 | H2AFZ "Histone H2A.Z" [Gallus | 0.838 | 0.890 | 0.850 | 8.8e-47 | |
| UNIPROTKB|P0C0S4 | 128 | H2AFZ "Histone H2A.Z" [Bos tau | 0.838 | 0.890 | 0.850 | 1.1e-46 | |
| UNIPROTKB|E2R678 | 128 | H2AFZ "Uncharacterized protein | 0.838 | 0.890 | 0.850 | 1.1e-46 | |
| UNIPROTKB|F6X834 | 128 | H2AFZ "Histone H2A" [Canis lup | 0.838 | 0.890 | 0.850 | 1.1e-46 | |
| UNIPROTKB|P0C0S5 | 128 | H2AFZ "Histone H2A.Z" [Homo sa | 0.838 | 0.890 | 0.850 | 1.1e-46 |
| TAIR|locus:2096951 HTA11 "histone H2A 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
Identities = 111/119 (93%), Positives = 117/119 (98%)
Query: 18 NKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEV 77
NKDKDKDKK+PISRS+RAGIQFPVGRIHR LK+R++AHGRVGATAAVY ASILEYLTAEV
Sbjct: 18 NKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEV 77
Query: 78 LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD 136
LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK+
Sbjct: 78 LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE 136
|
|
| TAIR|locus:2040384 HTA8 "histone H2A 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011456 HTA9 "histone H2A protein 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0001197 His2Av "Histone H2A variant" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z4M5 H2AFZ "Histone H2A" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZMD6 H2AFZ "Histone H2A.Z" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0C0S4 H2AFZ "Histone H2A.Z" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R678 H2AFZ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6X834 H2AFZ "Histone H2A" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0C0S5 H2AFZ "Histone H2A.Z" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| PLN00154 | 136 | PLN00154, PLN00154, histone H2A; Provisional | 2e-80 | |
| PTZ00017 | 134 | PTZ00017, PTZ00017, histone H2A; Provisional | 8e-59 | |
| cd00074 | 115 | cd00074, H2A, Histone 2A; H2A is a subunit of the | 3e-55 | |
| smart00414 | 106 | smart00414, H2A, Histone 2A | 2e-53 | |
| COG5262 | 132 | COG5262, HTA1, Histone H2A [Chromatin structure an | 1e-40 | |
| PLN00157 | 132 | PLN00157, PLN00157, histone H2A; Provisional | 2e-40 | |
| PLN00156 | 139 | PLN00156, PLN00156, histone H2AX; Provisional | 8e-37 | |
| PLN00153 | 129 | PLN00153, PLN00153, histone H2A; Provisional | 2e-33 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 3e-23 | |
| PTZ00252 | 134 | PTZ00252, PTZ00252, histone H2A; Provisional | 7e-21 | |
| PLN00155 | 58 | PLN00155, PLN00155, histone H2A; Provisional | 3e-09 | |
| COG5247 | 113 | COG5247, BUR6, Class 2 transcription repressor NC2 | 8e-04 |
| >gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional | Back alignment and domain information |
|---|
Score = 232 bits (594), Expect = 2e-80
Identities = 120/136 (88%), Positives = 127/136 (93%)
Query: 1 MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGA 60
M+GKGGKGLLAAKTTA KDKDKK+P SRSSRAG+QFPVGRIHR LK R++AHGRVGA
Sbjct: 1 MSGKGGKGLLAAKTTAAAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGA 60
Query: 61 TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
TAAVY A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG
Sbjct: 61 TAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
Query: 121 VIPHIHKSLINKTTKD 136
VIPHIHKSLINK+TK
Sbjct: 121 VIPHIHKSLINKSTKK 136
|
Length = 136 |
| >gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >gnl|CDD|197711 smart00414, H2A, Histone 2A | Back alignment and domain information |
|---|
| >gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| PLN00154 | 136 | histone H2A; Provisional | 100.0 | |
| PLN00157 | 132 | histone H2A; Provisional | 100.0 | |
| PLN00156 | 139 | histone H2AX; Provisional | 100.0 | |
| PLN00153 | 129 | histone H2A; Provisional | 100.0 | |
| PTZ00017 | 134 | histone H2A; Provisional | 100.0 | |
| PTZ00252 | 134 | histone H2A; Provisional | 100.0 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 100.0 | |
| KOG1756 | 131 | consensus Histone 2A [Chromatin structure and dyna | 100.0 | |
| smart00414 | 106 | H2A Histone 2A. | 100.0 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 100.0 | |
| KOG1757 | 131 | consensus Histone 2A [Chromatin structure and dyna | 100.0 | |
| PLN00155 | 58 | histone H2A; Provisional | 99.82 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.61 | |
| COG5247 | 113 | BUR6 Class 2 transcription repressor NC2, alpha su | 99.4 | |
| PLN00035 | 103 | histone H4; Provisional | 99.15 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 99.15 | |
| KOG1659 | 224 | consensus Class 2 transcription repressor NC2, alp | 99.13 | |
| PTZ00015 | 102 | histone H4; Provisional | 99.04 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.04 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 99.01 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 98.85 | |
| smart00417 | 74 | H4 Histone H4. | 98.8 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 98.22 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.17 | |
| KOG1657 | 236 | consensus CCAAT-binding factor, subunit C (HAP5) [ | 98.16 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 98.09 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 97.8 | |
| smart00428 | 105 | H3 Histone H3. | 97.76 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 97.68 | |
| PLN00158 | 116 | histone H2B; Provisional | 97.61 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 97.57 | |
| PTZ00463 | 117 | histone H2B; Provisional | 97.52 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 97.38 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 97.33 | |
| cd08048 | 85 | TAF11 TATA Binding Protein (TBP) Associated Factor | 97.22 | |
| smart00427 | 89 | H2B Histone H2B. | 97.15 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 97.04 | |
| PF04719 | 90 | TAFII28: hTAFII28-like protein conserved region; I | 96.72 | |
| PLN00161 | 135 | histone H3; Provisional | 96.65 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 96.56 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 96.51 | |
| KOG3219 | 195 | consensus Transcription initiation factor TFIID, s | 96.27 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 96.18 | |
| PLN00121 | 136 | histone H3; Provisional | 96.16 | |
| PLN00160 | 97 | histone H3; Provisional | 96.09 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 95.87 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 95.72 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 95.64 | |
| PTZ00018 | 136 | histone H3; Provisional | 95.63 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 95.28 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 93.73 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 93.08 | |
| KOG1658 | 162 | consensus DNA polymerase epsilon, subunit C [Repli | 93.03 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 92.56 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 91.84 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 91.01 | |
| KOG3334 | 148 | consensus Transcription initiation factor TFIID, s | 89.74 | |
| PF02861 | 53 | Clp_N: Clp amino terminal domain; InterPro: IPR004 | 82.49 |
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-48 Score=288.78 Aligned_cols=134 Identities=87% Similarity=1.226 Sum_probs=120.8
Q ss_pred CCCCCCCccccccccCCCCCCCCCCCCCCCcccccCcccchhhhhhhhhhccc-cccccCcchHHHHHHHHHHHHHHHHH
Q 032642 1 MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIA-AHGRVGATAAVYLASILEYLTAEVLE 79 (136)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~SsragL~fPVsrv~R~Lk~~~~-a~~RVs~~A~VyLaAvLEyL~~EILe 79 (136)
|++++|+++++++.++....+.+.+++..|+|+||||||||+||+|+|+++++ .+ ||+++|||||+||||||++||||
T Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~k~~srS~rAgL~FPVgRi~r~Lk~g~~~~~-RVga~ApVYLAAVLEYLtAEVLE 79 (136)
T PLN00154 1 MSGKGGKGLLAAKTTAAAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHG-RVGATAAVYTAAILEYLTAEVLE 79 (136)
T ss_pred CCCccccccccCCcCCcccccccCCcCCcCcccccCccCchHHHHHHHHhhhhhcc-ccccchHHHHHHHHHHHHHHHHH
Confidence 78889999888775442222334466899999999999999999999999974 44 99999999999999999999999
Q ss_pred HHHHHHHhcCCceechhhHHHHhhCChHHHhhhhccccCCCccCCcccccccccCC
Q 032642 80 LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK 135 (136)
Q Consensus 80 lAg~~A~~~~~krItp~hI~~AI~nD~EL~~Lf~~~ia~ggv~p~i~~~~~~~~~~ 135 (136)
+|+|+|+++++++|+|+||++||+||+||++||+.||++|||+|+||++|+|++++
T Consensus 80 LAGNaA~d~kk~RItPrHi~lAIrnDeEL~~Ll~~TIa~GGVlP~i~~~l~~k~~~ 135 (136)
T PLN00154 80 LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTK 135 (136)
T ss_pred HHHHHHHhhCCceecHHHhhhhccCcHHHHHHhcCCccCCccCCCcchhhcccccC
Confidence 99999999999999999999999999999999988999999999999999999875
|
|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >KOG1756 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1757 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN00155 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 136 | ||||
| 1f66_C | 128 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 2e-51 | ||
| 2jss_A | 192 | Nmr Structure Of Chaperone Chz1 Complexed With Hist | 3e-36 | ||
| 1eqz_A | 129 | X-Ray Structure Of The Nucleosome Core Particle At | 2e-31 | ||
| 2hio_A | 128 | Histone Octamer (Chicken), Chromosomal Protein Leng | 2e-31 | ||
| 1m18_C | 129 | Ligand Binding Alters The Structure And Dynamics Of | 4e-31 | ||
| 2nqb_C | 123 | Drosophila Nucleosome Structure Length = 123 | 4e-31 | ||
| 3c1b_C | 129 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 4e-31 | ||
| 1zbb_C | 129 | Structure Of The 4_601_167 Tetranucleosome Length = | 4e-31 | ||
| 2pyo_C | 120 | Drosophila Nucleosome Core Length = 120 | 5e-31 | ||
| 3kwq_C | 107 | Structural Characterization Of H3k56q Nucleosomes A | 2e-30 | ||
| 2cv5_C | 130 | Crystal Structure Of Human Nucleosome Core Particle | 2e-30 | ||
| 2f8n_K | 149 | 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc | 2e-30 | ||
| 1s32_C | 119 | Molecular Recognition Of The Nucleosomal 'supergroo | 2e-30 | ||
| 1aoi_C | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 2e-30 | ||
| 1zla_C | 129 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 3e-30 | ||
| 3a6n_C | 133 | The Nucleosome Containing A Testis-Specific Histone | 3e-30 | ||
| 1kx3_C | 128 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 4e-30 | ||
| 1hio_A | 95 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 4e-29 | ||
| 1id3_C | 131 | Crystal Structure Of The Yeast Nucleosome Core Part | 4e-28 | ||
| 2xql_A | 91 | Fitting Of The H2a-H2b Histones In The Electron Mic | 8e-27 | ||
| 1u35_C | 120 | Crystal Structure Of The Nucleosome Core Particle C | 1e-26 | ||
| 3ksy_A | 1049 | Crystal Structure Of The Histone Domain, Dh-Ph Unit | 4e-06 | ||
| 1q9c_A | 191 | Crystal Structure Of The Histone Domain Of Son Of S | 4e-06 |
| >pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 | Back alignment and structure |
|
| >pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 | Back alignment and structure |
| >pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 | Back alignment and structure |
| >pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 | Back alignment and structure |
| >pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 | Back alignment and structure |
| >pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 | Back alignment and structure |
| >pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 | Back alignment and structure |
| >pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 | Back alignment and structure |
| >pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 | Back alignment and structure |
| >pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 | Back alignment and structure |
| >pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 | Back alignment and structure |
| >pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 | Back alignment and structure |
| >pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 | Back alignment and structure |
| >pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 | Back alignment and structure |
| >pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 | Back alignment and structure |
| >pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 | Back alignment and structure |
| >pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 | Back alignment and structure |
| >pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 | Back alignment and structure |
| >pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 | Back alignment and structure |
| >pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 | Back alignment and structure |
| >pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 | Back alignment and structure |
| >pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 6e-39 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 1e-36 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 1e-36 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 1e-35 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 1e-34 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 3e-33 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 1e-27 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 2e-15 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 2e-10 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 5e-08 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 6e-04 |
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 | Back alignment and structure |
|---|
Score = 126 bits (318), Expect = 6e-39
Identities = 97/119 (81%), Positives = 104/119 (87%)
Query: 17 GNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAE 76
KD K K + +SRS RAG+QFPVGRIHRHLKSR +HGRVGATAAVY A+ILEYLTAE
Sbjct: 6 AGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65
Query: 77 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK 135
VLELAGNASKDLKVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K +
Sbjct: 66 VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124
|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 100.0 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 100.0 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 100.0 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 100.0 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 100.0 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 100.0 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 100.0 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 99.91 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 99.89 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 99.8 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 99.77 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 99.7 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.7 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.69 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.49 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.31 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 99.29 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.29 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.04 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 98.96 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 98.94 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 98.91 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 98.9 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 98.87 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 98.7 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 98.67 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.52 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.43 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 98.4 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.39 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 98.32 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.3 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 98.28 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 98.25 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 98.22 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 98.15 | |
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 98.13 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 98.06 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 98.05 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 98.0 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 97.95 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 97.5 | |
| 1bh9_B | 89 | TAFII28; histone fold, tata binding protein, trans | 96.68 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 96.66 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 96.4 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 95.3 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 94.75 | |
| 1wwi_A | 148 | Hypothetical protein TTHA1479; structural genomics | 90.76 | |
| 1k6k_A | 143 | ATP-dependent CLP protease ATP-binding subunit CLP | 90.32 | |
| 2y1q_A | 150 | CLPC N-domain, negative regulator of genetic compe | 84.54 | |
| 1khy_A | 148 | CLPB protein; alpha helix, chaperone; 1.95A {Esche | 83.93 | |
| 1r4v_A | 171 | Hypothetical protein AQ_328; structural genomics, | 83.5 | |
| 3fes_A | 145 | ATP-dependent CLP endopeptidase; alpha-helical bun | 83.09 | |
| 3fh2_A | 146 | Probable ATP-dependent protease (heat shock prote; | 83.05 |
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-46 Score=274.23 Aligned_cols=110 Identities=54% Similarity=0.842 Sum_probs=104.8
Q ss_pred CCCCCCcccccCcccchhhhhhhhhhccccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHhcCCceechhhHHHHhhC
Q 032642 25 KKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRG 104 (136)
Q Consensus 25 ~~~~~s~SsragL~fPVsrv~R~Lk~~~~a~~RVs~~A~VyLaAvLEyL~~EILelAg~~A~~~~~krItp~hI~~AI~n 104 (136)
+++.+|+|+|+||||||+||+|||++++|++ ||+++|+|||+||||||++||+|+|+|+|+++++++|+|+||++||+|
T Consensus 9 ~~~~~srs~ragLqfPV~ri~R~Lk~~~~a~-RV~~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~~rItp~hi~lAI~n 87 (120)
T 2f8n_G 9 KSTKTSRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVAN 87 (120)
T ss_dssp -CCCCCHHHHHTCSSCHHHHHHHHHHHSSSC-EECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHT
T ss_pred CcCCcCcccccCccCChHHHHHHHHcCcccc-ccccchHHHHHHHHHHHHHHHHHHHHHHHhhcCCceEcHHHHHHHHhc
Confidence 5567899999999999999999999999997 999999999999999999999999999999999999999999999999
Q ss_pred ChHHHhhhhc-cccCCCccCCcccccccccCC
Q 032642 105 DEELDTLIKG-TIAGGGVIPHIHKSLINKTTK 135 (136)
Q Consensus 105 D~EL~~Lf~~-~ia~ggv~p~i~~~~~~~~~~ 135 (136)
|+||++||++ ||++|||+|+||++|+||+.+
T Consensus 88 DeEL~~Ll~~vtia~ggv~p~i~~~l~~k~~~ 119 (120)
T 2f8n_G 88 DEELNQLLKGVTIASGGVLPNIHPELLAKKRG 119 (120)
T ss_dssp SHHHHHHTTTEEETTCCCCCCCCGGGSCCC--
T ss_pred CHHHHHHhCCceECCCCcCCCcCHHHcCCccC
Confidence 9999999999 999999999999999999865
|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A | Back alignment and structure |
|---|
| >1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* | Back alignment and structure |
|---|
| >2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A | Back alignment and structure |
|---|
| >1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 | Back alignment and structure |
|---|
| >1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 | Back alignment and structure |
|---|
| >3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} | Back alignment and structure |
|---|
| >3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d1u35c1 | 106 | a.22.1.1 (C:814-919) macro-H2A.1, histone domain { | 2e-49 | |
| d1f66c_ | 103 | a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v | 2e-48 | |
| d1tzya_ | 106 | a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) | 7e-48 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 2e-35 | |
| d1jfia_ | 66 | a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai | 7e-17 | |
| d1n1jb_ | 78 | a.22.1.3 (B:) Nuclear transcription factor Y subun | 1e-16 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 8e-10 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 9e-06 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 0.002 |
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: macro-H2A.1, histone domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 151 bits (383), Expect = 2e-49
Identities = 58/104 (55%), Positives = 80/104 (76%), Gaps = 2/104 (1%)
Query: 30 SRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLK 89
SRS++AG+ FPVGR+ R++K + R+G A VY+A++LEYLTAE+LELA NA++D K
Sbjct: 3 SRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAVNAARDNK 61
Query: 90 VKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132
R+TPRH+ LA+ DEEL+ L+KG TIA GGV+P+IH L+ K
Sbjct: 62 KGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAK 105
|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 100.0 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 100.0 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 99.96 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 99.66 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 99.55 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.42 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.25 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.24 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 99.08 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.95 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 98.81 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 98.72 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 98.61 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 98.57 | |
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 97.57 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 97.54 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 97.23 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 96.7 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 96.39 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 94.38 | |
| d1k6ka_ | 142 | N-terminal, ClpS-binding domain of ClpA, an Hsp100 | 92.0 | |
| d1wwia1 | 148 | Hypothetical protein TTHA1479 {Thermus thermophilu | 91.05 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 89.69 | |
| d1qvra1 | 145 | N-terminal domain of ClpB (heat shock protein F84. | 89.02 | |
| d1khya_ | 139 | N-terminal domain of ClpB (heat shock protein F84. | 88.32 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 81.8 |
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H2A species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=2.1e-46 Score=267.27 Aligned_cols=105 Identities=65% Similarity=0.958 Sum_probs=102.5
Q ss_pred CCCCcccccCcccchhhhhhhhhhccccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHhcCCceechhhHHHHhhCCh
Q 032642 27 RPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDE 106 (136)
Q Consensus 27 ~~~s~SsragL~fPVsrv~R~Lk~~~~a~~RVs~~A~VyLaAvLEyL~~EILelAg~~A~~~~~krItp~hI~~AI~nD~ 106 (136)
+.+|+|+||||||||+||+|+|++++|++ ||+++|||||+||||||++||||+|+|+|+++++++|+|+||++||+||+
T Consensus 1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~-rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDe 79 (106)
T d1tzya_ 1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDE 79 (106)
T ss_dssp CCCCHHHHHTCSSCHHHHHHHHHHTTSSS-EECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSH
T ss_pred CCccccccCCccCChHHHHHHHHcCcccc-ccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHH
Confidence 46899999999999999999999999987 99999999999999999999999999999999999999999999999999
Q ss_pred HHHhhhhc-cccCCCccCCcccccccc
Q 032642 107 ELDTLIKG-TIAGGGVIPHIHKSLINK 132 (136)
Q Consensus 107 EL~~Lf~~-~ia~ggv~p~i~~~~~~~ 132 (136)
||++||.+ ||++|||+|+||++|+||
T Consensus 80 eL~~L~~~vtI~~GGv~P~Ih~~Llpk 106 (106)
T d1tzya_ 80 ELNKLLGKVTIAQGGVLPNIQAVLLPK 106 (106)
T ss_dssp HHHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred HHHHHHcCCeecCCCccCccCHhhcCC
Confidence 99999999 999999999999999987
|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|