Citrus Sinensis ID: 032642


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD
ccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccHHHHHHHHccccccccccccccccccccccc
cccccccccEccccccccccccccccccccHHHHHcccccHHHHHHHHHcccccccEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHcHHHHHHcccEEccccccccHHHHHccccccc
magkggkgllaakttagnkdkdkdkkrpisrssragiqfpvgRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGnaskdlkvkritpRHLQLAIRGDEELDTLIKgtiagggviphIHKSLINKTTKD
magkggkgllaakttagnkdkdkdkkrpisrssragiqfpvgriHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAgnaskdlkvkritprhlqlairgdeelDTLIKGtiagggviphihkslinkttkd
MagkggkgllaakttagNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD
************************************IQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLI******
************************************IQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHK**IN*****
MAGKGGKGLLAAKT****************RSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD
***********************************GIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
O23628136 Histone H2A variant 1 OS= yes no 1.0 1.0 0.919 2e-61
Q9SII0136 Probable histone H2A vari no no 1.0 1.0 0.889 6e-60
Q84MP7137 Probable histone H2A vari yes no 1.0 0.992 0.861 6e-57
Q8H7Y8138 Probable histone H2A vari no no 1.0 0.985 0.847 7e-55
Q8S857139 Probable histone H2A vari no no 1.0 0.978 0.863 3e-54
Q9C944134 Probable histone H2A vari no no 0.985 1.0 0.816 1e-52
Q5ZMD6128 Histone H2A.Z OS=Gallus g yes no 0.838 0.890 0.850 3e-50
P08985141 Histone H2A.v OS=Drosophi yes no 0.838 0.808 0.850 3e-50
Q6YNC8128 Histone H2A.Z OS=Ovis ari N/A no 0.838 0.890 0.850 3e-50
P0C0S7128 Histone H2A.Z OS=Rattus n yes no 0.838 0.890 0.850 3e-50
>sp|O23628|H2AV1_ARATH Histone H2A variant 1 OS=Arabidopsis thaliana GN=H2AV PE=1 SV=1 Back     alignment and function desciption
 Score =  233 bits (595), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/136 (91%), Positives = 132/136 (97%)

Query: 1   MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGA 60
           MAGKGGKGL+AAKT A NKDKDKDKK+PISRS+RAGIQFPVGRIHR LK+R++AHGRVGA
Sbjct: 1   MAGKGGKGLVAAKTMAANKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGA 60

Query: 61  TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
           TAAVY ASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG
Sbjct: 61  TAAVYTASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120

Query: 121 VIPHIHKSLINKTTKD 136
           VIPHIHKSLINKTTK+
Sbjct: 121 VIPHIHKSLINKTTKE 136




Variant histone H2A which may replace conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SII0|H2AV2_ARATH Probable histone H2A variant 2 OS=Arabidopsis thaliana GN=At2g38810 PE=2 SV=1 Back     alignment and function description
>sp|Q84MP7|H2AV3_ORYSJ Probable histone H2A variant 3 OS=Oryza sativa subsp. japonica GN=Os03g0743400 PE=2 SV=1 Back     alignment and function description
>sp|Q8H7Y8|H2AV1_ORYSJ Probable histone H2A variant 1 OS=Oryza sativa subsp. japonica GN=Os03g0162200 PE=2 SV=1 Back     alignment and function description
>sp|Q8S857|H2AV2_ORYSJ Probable histone H2A variant 2 OS=Oryza sativa subsp. japonica GN=Os10g0418000 PE=2 SV=1 Back     alignment and function description
>sp|Q9C944|H2AV3_ARATH Probable histone H2A variant 3 OS=Arabidopsis thaliana GN=At1g52740 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZMD6|H2AZ_CHICK Histone H2A.Z OS=Gallus gallus GN=H2AFZ PE=1 SV=3 Back     alignment and function description
>sp|P08985|H2AV_DROME Histone H2A.v OS=Drosophila melanogaster GN=His2Av PE=1 SV=2 Back     alignment and function description
>sp|Q6YNC8|H2AZ_SHEEP Histone H2A.Z OS=Ovis aries GN=H2AFZ PE=2 SV=3 Back     alignment and function description
>sp|P0C0S7|H2AZ_RAT Histone H2A.Z OS=Rattus norvegicus GN=H2afz PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
388522207134 unknown [Medicago truncatula] 0.985 1.0 0.904 8e-62
351734436136 uncharacterized protein LOC100306323 [Gl 1.0 1.0 0.948 7e-61
224062285137 histone 2 [Populus trichocarpa] gi|11848 1.0 0.992 0.948 9e-61
388506528135 unknown [Lotus japonicus] 0.992 1.0 0.897 1e-60
226532207138 uncharacterized protein LOC100273753 [Ze 1.0 0.985 0.884 1e-60
449455262136 PREDICTED: histone H2A variant 1-like is 1.0 1.0 0.941 3e-60
224085557139 histone 2 [Populus trichocarpa] gi|11848 1.0 0.978 0.928 1e-59
15232536136 histone H2A [Arabidopsis thaliana] gi|29 1.0 1.0 0.919 2e-59
356504967136 PREDICTED: histone H2A variant 1-like [G 1.0 1.0 0.911 7e-59
15224957136 histone H2A 8 [Arabidopsis thaliana] gi| 1.0 1.0 0.889 5e-58
>gi|388522207|gb|AFK49165.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 123/136 (90%), Positives = 127/136 (93%), Gaps = 2/136 (1%)

Query: 1   MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGA 60
           MAGKGGKGL+AAKTTA NKDKDK  KRP SRSSRAGIQFPVGRIHR LK R+ A+GRVGA
Sbjct: 1   MAGKGGKGLVAAKTTAANKDKDK--KRPTSRSSRAGIQFPVGRIHRQLKQRVQANGRVGA 58

Query: 61  TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
           TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTL KGTIAGGG
Sbjct: 59  TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLTKGTIAGGG 118

Query: 121 VIPHIHKSLINKTTKD 136
           VIPHIHKSLINKT K+
Sbjct: 119 VIPHIHKSLINKTAKE 134




Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|351734436|ref|NP_001237025.1| uncharacterized protein LOC100306323 [Glycine max] gi|356500154|ref|XP_003518898.1| PREDICTED: histone H2A variant 1-like [Glycine max] gi|255628201|gb|ACU14445.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224062285|ref|XP_002300810.1| histone 2 [Populus trichocarpa] gi|118482024|gb|ABK92943.1| unknown [Populus trichocarpa] gi|222842536|gb|EEE80083.1| histone 2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388506528|gb|AFK41330.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|226532207|ref|NP_001141633.1| uncharacterized protein LOC100273753 [Zea mays] gi|242065684|ref|XP_002454131.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor] gi|194705342|gb|ACF86755.1| unknown [Zea mays] gi|195605334|gb|ACG24497.1| histone H2A variant 1 [Zea mays] gi|195605602|gb|ACG24631.1| histone H2A variant 1 [Zea mays] gi|195624562|gb|ACG34111.1| histone H2A variant 1 [Zea mays] gi|241933962|gb|EES07107.1| hypothetical protein SORBIDRAFT_04g025140 [Sorghum bicolor] gi|414864935|tpg|DAA43492.1| TPA: histone H2A [Zea mays] Back     alignment and taxonomy information
>gi|449455262|ref|XP_004145372.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449455264|ref|XP_004145373.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449470505|ref|XP_004152957.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449470507|ref|XP_004152958.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449509347|ref|XP_004163562.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449509351|ref|XP_004163563.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224085557|ref|XP_002307619.1| histone 2 [Populus trichocarpa] gi|118486969|gb|ABK95317.1| unknown [Populus trichocarpa] gi|222857068|gb|EEE94615.1| histone 2 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|15232536|ref|NP_191019.1| histone H2A [Arabidopsis thaliana] gi|297816752|ref|XP_002876259.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata] gi|75277395|sp|O23628.1|H2AV1_ARATH RecName: Full=Histone H2A variant 1; AltName: Full=H2A.F/Z 1; AltName: Full=H2AvAt; AltName: Full=HTA11 gi|2407800|emb|CAA73155.1| histone H2A.F/Z [Arabidopsis thaliana] gi|7258359|emb|CAB77576.1| histone H2A.F/Z [Arabidopsis thaliana] gi|21592838|gb|AAM64788.1| histone H2A.F/Z [Arabidopsis thaliana] gi|28950691|gb|AAO63269.1| At3g54560 [Arabidopsis thaliana] gi|110736078|dbj|BAF00012.1| histone H2A.F/Z [Arabidopsis thaliana] gi|297322097|gb|EFH52518.1| histone H2A.F/Z [Arabidopsis lyrata subsp. lyrata] gi|332645729|gb|AEE79250.1| histone H2A [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356504967|ref|XP_003521264.1| PREDICTED: histone H2A variant 1-like [Glycine max] gi|356572232|ref|XP_003554274.1| PREDICTED: histone H2A variant 1-like [Glycine max] Back     alignment and taxonomy information
>gi|15224957|ref|NP_181415.1| histone H2A 8 [Arabidopsis thaliana] gi|30687643|ref|NP_850298.1| histone H2A 8 [Arabidopsis thaliana] gi|30687646|ref|NP_850299.1| histone H2A 8 [Arabidopsis thaliana] gi|75313476|sp|Q9SII0.1|H2AV2_ARATH RecName: Full=Probable histone H2A variant 2; AltName: Full=H2A.F/Z 2; AltName: Full=HTA8 gi|4585900|gb|AAD25562.1| histone H2A [Arabidopsis thaliana] gi|21595470|gb|AAM66104.1| histone H2A [Arabidopsis thaliana] gi|62319094|dbj|BAD94243.1| histone H2A [Arabidopsis thaliana] gi|110736503|dbj|BAF00219.1| histone H2A [Arabidopsis thaliana] gi|111074314|gb|ABH04530.1| At2g38810 [Arabidopsis thaliana] gi|330254492|gb|AEC09586.1| histone H2A 8 [Arabidopsis thaliana] gi|330254493|gb|AEC09587.1| histone H2A 8 [Arabidopsis thaliana] gi|330254494|gb|AEC09588.1| histone H2A 8 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2096951136 HTA11 "histone H2A 11" [Arabid 0.875 0.875 0.932 6.1e-55
TAIR|locus:2040384136 HTA8 "histone H2A 8" [Arabidop 0.860 0.860 0.897 6.5e-51
TAIR|locus:2011456134 HTA9 "histone H2A protein 9" [ 0.860 0.873 0.880 8.3e-51
FB|FBgn0001197141 His2Av "Histone H2A variant" [ 0.838 0.808 0.850 8.8e-47
UNIPROTKB|F2Z4M5127 H2AFZ "Histone H2A" [Gallus ga 0.838 0.897 0.850 8.8e-47
UNIPROTKB|Q5ZMD6128 H2AFZ "Histone H2A.Z" [Gallus 0.838 0.890 0.850 8.8e-47
UNIPROTKB|P0C0S4128 H2AFZ "Histone H2A.Z" [Bos tau 0.838 0.890 0.850 1.1e-46
UNIPROTKB|E2R678128 H2AFZ "Uncharacterized protein 0.838 0.890 0.850 1.1e-46
UNIPROTKB|F6X834128 H2AFZ "Histone H2A" [Canis lup 0.838 0.890 0.850 1.1e-46
UNIPROTKB|P0C0S5128 H2AFZ "Histone H2A.Z" [Homo sa 0.838 0.890 0.850 1.1e-46
TAIR|locus:2096951 HTA11 "histone H2A 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 567 (204.7 bits), Expect = 6.1e-55, P = 6.1e-55
 Identities = 111/119 (93%), Positives = 117/119 (98%)

Query:    18 NKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEV 77
             NKDKDKDKK+PISRS+RAGIQFPVGRIHR LK+R++AHGRVGATAAVY ASILEYLTAEV
Sbjct:    18 NKDKDKDKKKPISRSARAGIQFPVGRIHRQLKTRVSAHGRVGATAAVYTASILEYLTAEV 77

Query:    78 LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKD 136
             LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK+
Sbjct:    78 LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTKE 136




GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0005515 "protein binding" evidence=IPI
GO:0009908 "flower development" evidence=IGI
GO:0042742 "defense response to bacterium" evidence=IGI;RCA
GO:0016048 "detection of temperature stimulus" evidence=IGI
GO:0006338 "chromatin remodeling" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010468 "regulation of gene expression" evidence=IGI
GO:0044030 "regulation of DNA methylation" evidence=IGI
TAIR|locus:2040384 HTA8 "histone H2A 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011456 HTA9 "histone H2A protein 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0001197 His2Av "Histone H2A variant" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4M5 H2AFZ "Histone H2A" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMD6 H2AFZ "Histone H2A.Z" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P0C0S4 H2AFZ "Histone H2A.Z" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R678 H2AFZ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6X834 H2AFZ "Histone H2A" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P0C0S5 H2AFZ "Histone H2A.Z" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4PHE4H2AZ_USTMANo assigned EC number0.65150.91170.9185N/Ano
Q5RC42H2AZ_PONABNo assigned EC number0.85080.83820.8906yesno
Q2UJ80H2AZ_ASPORNo assigned EC number0.65210.84550.8333yesno
A5DXC6H2AZ_LODELNo assigned EC number0.70.80880.8270N/Ano
Q8H7Y8H2AV1_ORYSJNo assigned EC number0.84781.00.9855nono
Q6DER6H2AZL_XENTRNo assigned EC number0.82450.83820.8906nono
Q6Y237H2AV_PAGMANo assigned EC number0.84210.83820.8906N/Ano
Q3THW5H2AV_MOUSENo assigned EC number0.84210.83820.8906yesno
Q4IMD1H2AZ_GIBZENo assigned EC number0.68180.80880.7638yesno
A5DQL2H2AZ_PICGUNo assigned EC number0.70.80880.8270N/Ano
Q32LA7H2AV_BOVINNo assigned EC number0.84210.83820.8906yesno
Q12692H2AZ_YEASTNo assigned EC number0.62770.93380.9477yesno
Q71PD7H2AV_DANRENo assigned EC number0.84210.83820.8906yesno
Q84MP7H2AV3_ORYSJNo assigned EC number0.86131.00.9927yesno
P02272H2AV_CHICKNo assigned EC number0.84210.83820.8906yesno
P08991H2AV_STRPUNo assigned EC number0.84210.83820.912yesno
Q6GM74H2AV_XENLANo assigned EC number0.84210.83820.8906N/Ano
O23628H2AV1_ARATHNo assigned EC number0.91911.01.0yesno
P22647H2AZ_ONCMYNo assigned EC number0.85080.83820.8906N/Ano
A3GHC1H2AZ_PICSTNo assigned EC number0.70.80880.8333yesno
Q5ZMD6H2AZ_CHICKNo assigned EC number0.85080.83820.8906yesno
Q9C944H2AV3_ARATHNo assigned EC number0.81610.98521.0nono
Q6BQE9H2AZ_DEBHANo assigned EC number0.70.80880.8333yesno
Q6YNC8H2AZ_SHEEPNo assigned EC number0.85080.83820.8906N/Ano
Q8S857H2AV2_ORYSJNo assigned EC number0.86331.00.9784nono
Q6CUC8H2AZ_KLULANo assigned EC number0.62040.93380.9621yesno
P0CO00H2AZ_CRYNJNo assigned EC number0.76920.76470.7536yesno
P0CO01H2AZ_CRYNBNo assigned EC number0.76920.76470.7536N/Ano
P08985H2AV_DROMENo assigned EC number0.85080.83820.8085yesno
Q75CC6H2AZ_ASHGONo assigned EC number0.71690.77940.7969yesno
P0C0S6H2AZ_MOUSENo assigned EC number0.85080.83820.8906yesno
P0C0S7H2AZ_RATNo assigned EC number0.85080.83820.8906yesno
P0C0S4H2AZ_BOVINNo assigned EC number0.85080.83820.8906yesno
P0C0S5H2AZ_HUMANNo assigned EC number0.85080.83820.8906yesno
P70094H2AZL_XENLANo assigned EC number0.82450.83820.8906N/Ano
O62695H2AV_RABITNo assigned EC number0.83330.83820.8906yesno
Q6C341H2AZ_YARLINo assigned EC number0.71690.77940.7571yesno
Q27511H2AV_CAEELNo assigned EC number0.80700.83820.8142yesno
Q1DTG2H2AZ_COCIMNo assigned EC number0.66080.84550.8333N/Ano
A2R702H2AZ_ASPNCNo assigned EC number0.65210.84550.8333yesno
Q5AEE1H2AZ_CANALNo assigned EC number0.70.80880.8270N/Ano
Q71UI9H2AV_HUMANNo assigned EC number0.84210.83820.8906yesno
P48003H2AZ_SCHPONo assigned EC number0.73330.77200.7553yesno
Q5BJ65H2AV_XENTRNo assigned EC number0.84210.83820.8906yesno
P08992H2AV_TETTSNo assigned EC number0.79090.80140.7465N/Ano
Q9SII0H2AV2_ARATHNo assigned EC number0.88971.01.0nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
PLN00154136 PLN00154, PLN00154, histone H2A; Provisional 2e-80
PTZ00017134 PTZ00017, PTZ00017, histone H2A; Provisional 8e-59
cd00074115 cd00074, H2A, Histone 2A; H2A is a subunit of the 3e-55
smart00414106 smart00414, H2A, Histone 2A 2e-53
COG5262132 COG5262, HTA1, Histone H2A [Chromatin structure an 1e-40
PLN00157132 PLN00157, PLN00157, histone H2A; Provisional 2e-40
PLN00156139 PLN00156, PLN00156, histone H2AX; Provisional 8e-37
PLN00153129 PLN00153, PLN00153, histone H2A; Provisional 2e-33
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 3e-23
PTZ00252134 PTZ00252, PTZ00252, histone H2A; Provisional 7e-21
PLN0015558 PLN00155, PLN00155, histone H2A; Provisional 3e-09
COG5247113 COG5247, BUR6, Class 2 transcription repressor NC2 8e-04
>gnl|CDD|177756 PLN00154, PLN00154, histone H2A; Provisional Back     alignment and domain information
 Score =  232 bits (594), Expect = 2e-80
 Identities = 120/136 (88%), Positives = 127/136 (93%)

Query: 1   MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGA 60
           M+GKGGKGLLAAKTTA    KDKDKK+P SRSSRAG+QFPVGRIHR LK R++AHGRVGA
Sbjct: 1   MSGKGGKGLLAAKTTAAAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHGRVGA 60

Query: 61  TAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120
           TAAVY A+ILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG
Sbjct: 61  TAAVYTAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGG 120

Query: 121 VIPHIHKSLINKTTKD 136
           VIPHIHKSLINK+TK 
Sbjct: 121 VIPHIHKSLINKSTKK 136


Length = 136

>gnl|CDD|185399 PTZ00017, PTZ00017, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|238029 cd00074, H2A, Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>gnl|CDD|197711 smart00414, H2A, Histone 2A Back     alignment and domain information
>gnl|CDD|227587 COG5262, HTA1, Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|177758 PLN00157, PLN00157, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|215080 PLN00156, PLN00156, histone H2AX; Provisional Back     alignment and domain information
>gnl|CDD|165721 PLN00153, PLN00153, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|240330 PTZ00252, PTZ00252, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|165723 PLN00155, PLN00155, histone H2A; Provisional Back     alignment and domain information
>gnl|CDD|227572 COG5247, BUR6, Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PLN00154136 histone H2A; Provisional 100.0
PLN00157132 histone H2A; Provisional 100.0
PLN00156139 histone H2AX; Provisional 100.0
PLN00153129 histone H2A; Provisional 100.0
PTZ00017134 histone H2A; Provisional 100.0
PTZ00252134 histone H2A; Provisional 100.0
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 100.0
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 100.0
smart00414106 H2A Histone 2A. 100.0
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 100.0
KOG1757131 consensus Histone 2A [Chromatin structure and dyna 100.0
PLN0015558 histone H2A; Provisional 99.82
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.61
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 99.4
PLN00035103 histone H4; Provisional 99.15
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 99.15
KOG1659 224 consensus Class 2 transcription repressor NC2, alp 99.13
PTZ00015102 histone H4; Provisional 99.04
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.04
smart0080365 TAF TATA box binding protein associated factor. TA 99.01
cd0007685 H4 Histone H4, one of the four histones, along wit 98.85
smart0041774 H4 Histone H4. 98.8
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.22
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 98.17
KOG1657236 consensus CCAAT-binding factor, subunit C (HAP5) [ 98.16
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 98.09
smart0057677 BTP Bromodomain transcription factors and PHD doma 97.8
smart00428105 H3 Histone H3. 97.76
PF0296966 TAF: TATA box binding protein associated factor (T 97.68
PLN00158116 histone H2B; Provisional 97.61
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 97.57
PTZ00463117 histone H2B; Provisional 97.52
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 97.38
KOG0869168 consensus CCAAT-binding factor, subunit A (HAP3) [ 97.33
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 97.22
smart0042789 H2B Histone H2B. 97.15
KOG3467103 consensus Histone H4 [Chromatin structure and dyna 97.04
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 96.72
PLN00161135 histone H3; Provisional 96.65
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 96.56
KOG1744127 consensus Histone H2B [Chromatin structure and dyn 96.51
KOG3219195 consensus Transcription initiation factor TFIID, s 96.27
KOG0871156 consensus Class 2 transcription repressor NC2, bet 96.18
PLN00121136 histone H3; Provisional 96.16
PLN0016097 histone H3; Provisional 96.09
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 95.87
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 95.72
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 95.64
PTZ00018136 histone H3; Provisional 95.63
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 95.28
KOG0870172 consensus DNA polymerase epsilon, subunit D [Trans 93.73
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 93.08
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 93.03
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 92.56
KOG1745137 consensus Histones H3 and H4 [Chromatin structure 91.84
KOG1142258 consensus Transcription initiation factor TFIID, s 91.01
KOG3334148 consensus Transcription initiation factor TFIID, s 89.74
PF0286153 Clp_N: Clp amino terminal domain; InterPro: IPR004 82.49
>PLN00154 histone H2A; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.5e-48  Score=288.78  Aligned_cols=134  Identities=87%  Similarity=1.226  Sum_probs=120.8

Q ss_pred             CCCCCCCccccccccCCCCCCCCCCCCCCCcccccCcccchhhhhhhhhhccc-cccccCcchHHHHHHHHHHHHHHHHH
Q 032642            1 MAGKGGKGLLAAKTTAGNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIA-AHGRVGATAAVYLASILEYLTAEVLE   79 (136)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~SsragL~fPVsrv~R~Lk~~~~-a~~RVs~~A~VyLaAvLEyL~~EILe   79 (136)
                      |++++|+++++++.++....+.+.+++..|+|+||||||||+||+|+|+++++ .+ ||+++|||||+||||||++||||
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~k~~srS~rAgL~FPVgRi~r~Lk~g~~~~~-RVga~ApVYLAAVLEYLtAEVLE   79 (136)
T PLN00154          1 MSGKGGKGLLAAKTTAAAAKKDKDKKKPTSRSSRAGLQFPVGRIHRQLKQRVSAHG-RVGATAAVYTAAILEYLTAEVLE   79 (136)
T ss_pred             CCCccccccccCCcCCcccccccCCcCCcCcccccCccCchHHHHHHHHhhhhhcc-ccccchHHHHHHHHHHHHHHHHH
Confidence            78889999888775442222334466899999999999999999999999974 44 99999999999999999999999


Q ss_pred             HHHHHHHhcCCceechhhHHHHhhCChHHHhhhhccccCCCccCCcccccccccCC
Q 032642           80 LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK  135 (136)
Q Consensus        80 lAg~~A~~~~~krItp~hI~~AI~nD~EL~~Lf~~~ia~ggv~p~i~~~~~~~~~~  135 (136)
                      +|+|+|+++++++|+|+||++||+||+||++||+.||++|||+|+||++|+|++++
T Consensus        80 LAGNaA~d~kk~RItPrHi~lAIrnDeEL~~Ll~~TIa~GGVlP~i~~~l~~k~~~  135 (136)
T PLN00154         80 LAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKSTK  135 (136)
T ss_pred             HHHHHHHhhCCceecHHHhhhhccCcHHHHHHhcCCccCCccCCCcchhhcccccC
Confidence            99999999999999999999999999999999988999999999999999999875



>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1757 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00155 histone H2A; Provisional Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>KOG3467 consensus Histone H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG1744 consensus Histone H2B [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] Back     alignment and domain information
>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF02861 Clp_N: Clp amino terminal domain; InterPro: IPR004176 This short domain is found in one or two copies at the amino terminus of ClpA and ClpB proteins from bacteria and eukaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1f66_C128 2.6 A Crystal Structure Of A Nucleosome Core Partic 2e-51
2jss_A192 Nmr Structure Of Chaperone Chz1 Complexed With Hist 3e-36
1eqz_A129 X-Ray Structure Of The Nucleosome Core Particle At 2e-31
2hio_A128 Histone Octamer (Chicken), Chromosomal Protein Leng 2e-31
1m18_C129 Ligand Binding Alters The Structure And Dynamics Of 4e-31
2nqb_C123 Drosophila Nucleosome Structure Length = 123 4e-31
3c1b_C129 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 4e-31
1zbb_C129 Structure Of The 4_601_167 Tetranucleosome Length = 4e-31
2pyo_C120 Drosophila Nucleosome Core Length = 120 5e-31
3kwq_C107 Structural Characterization Of H3k56q Nucleosomes A 2e-30
2cv5_C130 Crystal Structure Of Human Nucleosome Core Particle 2e-30
2f8n_K149 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nuc 2e-30
1s32_C119 Molecular Recognition Of The Nucleosomal 'supergroo 2e-30
1aoi_C116 Complex Between Nucleosome Core Particle (H3,H4,H2a 2e-30
1zla_C129 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 3e-30
3a6n_C133 The Nucleosome Containing A Testis-Specific Histone 3e-30
1kx3_C128 X-Ray Structure Of The Nucleosome Core Particle, Nc 4e-30
1hio_A95 Histone Octamer (Chicken), Chromosomal Protein, Alp 4e-29
1id3_C131 Crystal Structure Of The Yeast Nucleosome Core Part 4e-28
2xql_A91 Fitting Of The H2a-H2b Histones In The Electron Mic 8e-27
1u35_C120 Crystal Structure Of The Nucleosome Core Particle C 1e-26
3ksy_A 1049 Crystal Structure Of The Histone Domain, Dh-Ph Unit 4e-06
1q9c_A191 Crystal Structure Of The Histone Domain Of Son Of S 4e-06
>pdb|1F66|C Chain C, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 128 Back     alignment and structure

Iteration: 1

Score = 196 bits (499), Expect = 2e-51, Method: Compositional matrix adjust. Identities = 97/115 (84%), Positives = 103/115 (89%) Query: 18 NKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEV 77 KD K K + +SRS RAG+QFPVGRIHRHLKSR +HGRVGATAAVY A+ILEYLTAEV Sbjct: 7 GKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEV 66 Query: 78 LELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINK 132 LELAGNASKDLKVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K Sbjct: 67 LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGK 121
>pdb|2JSS|A Chain A, Nmr Structure Of Chaperone Chz1 Complexed With Histone H2a.Z-H2b Length = 192 Back     alignment and structure
>pdb|1EQZ|A Chain A, X-Ray Structure Of The Nucleosome Core Particle At 2.5 A Resolution Length = 129 Back     alignment and structure
>pdb|2HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein Length = 128 Back     alignment and structure
>pdb|1M18|C Chain C, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 129 Back     alignment and structure
>pdb|2NQB|C Chain C, Drosophila Nucleosome Structure Length = 123 Back     alignment and structure
>pdb|3C1B|C Chain C, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 129 Back     alignment and structure
>pdb|1ZBB|C Chain C, Structure Of The 4_601_167 Tetranucleosome Length = 129 Back     alignment and structure
>pdb|2PYO|C Chain C, Drosophila Nucleosome Core Length = 120 Back     alignment and structure
>pdb|3KWQ|C Chain C, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 107 Back     alignment and structure
>pdb|2CV5|C Chain C, Crystal Structure Of Human Nucleosome Core Particle Length = 130 Back     alignment and structure
>pdb|2F8N|K Chain K, 2.9 Angstrom X-Ray Structure Of Hybrid Macroh2a Nucleosomes Length = 149 Back     alignment and structure
>pdb|1S32|C Chain C, Molecular Recognition Of The Nucleosomal 'supergroove' Length = 119 Back     alignment and structure
>pdb|1AOI|C Chain C, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|1ZLA|C Chain C, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 129 Back     alignment and structure
>pdb|3A6N|C Chain C, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 133 Back     alignment and structure
>pdb|1KX3|C Chain C, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 128 Back     alignment and structure
>pdb|1HIO|A Chain A, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 95 Back     alignment and structure
>pdb|1ID3|C Chain C, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 131 Back     alignment and structure
>pdb|2XQL|A Chain A, Fitting Of The H2a-H2b Histones In The Electron Microscopy Map Of The Complex Nucleoplasmin:h2a-H2b Histones (1:5). Length = 91 Back     alignment and structure
>pdb|1U35|C Chain C, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a Length = 120 Back     alignment and structure
>pdb|3KSY|A Chain A, Crystal Structure Of The Histone Domain, Dh-Ph Unit, And Catalytic Unit Of The Ras Activator Son Of Sevenless (Sos) Length = 1049 Back     alignment and structure
>pdb|1Q9C|A Chain A, Crystal Structure Of The Histone Domain Of Son Of Sevenless Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 6e-39
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 1e-36
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 1e-36
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 1e-35
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 1e-34
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 3e-33
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 1e-27
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 2e-15
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 2e-10
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 5e-08
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 6e-04
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Length = 128 Back     alignment and structure
 Score =  126 bits (318), Expect = 6e-39
 Identities = 97/119 (81%), Positives = 104/119 (87%)

Query: 17  GNKDKDKDKKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAE 76
             KD  K K + +SRS RAG+QFPVGRIHRHLKSR  +HGRVGATAAVY A+ILEYLTAE
Sbjct: 6   AGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAE 65

Query: 77  VLELAGNASKDLKVKRITPRHLQLAIRGDEELDTLIKGTIAGGGVIPHIHKSLINKTTK 135
           VLELAGNASKDLKVKRITPRHLQLAIRGDEELD+LIK TIAGGGVIPHIHKSLI K  +
Sbjct: 66  VLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQ 124


>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Length = 129 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Length = 149 Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Length = 120 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Length = 123 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Length = 131 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Length = 192 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 98 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Length = 1049 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 100.0
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 100.0
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 100.0
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 100.0
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 100.0
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 100.0
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 100.0
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 99.91
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.89
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.8
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.77
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.7
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.7
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.69
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.49
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.31
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 99.29
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.29
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.04
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 98.96
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 98.94
1f1e_A154 Histone fold protein; archaeal histone protein, DN 98.91
1taf_B70 TFIID TBP associated factor 62; transcription init 98.9
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 98.87
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 98.7
1taf_A68 TFIID TBP associated factor 42; transcription init 98.67
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 98.52
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 98.43
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 98.4
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 98.39
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 98.32
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 98.3
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 98.28
3r45_A156 Histone H3-like centromeric protein A; histone fol 98.25
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 98.22
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 98.15
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 98.13
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 98.06
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 98.05
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 98.0
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 97.95
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 97.5
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 96.68
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 96.66
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 96.4
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 95.3
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 94.75
1wwi_A148 Hypothetical protein TTHA1479; structural genomics 90.76
1k6k_A143 ATP-dependent CLP protease ATP-binding subunit CLP 90.32
2y1q_A150 CLPC N-domain, negative regulator of genetic compe 84.54
1khy_A148 CLPB protein; alpha helix, chaperone; 1.95A {Esche 83.93
1r4v_A171 Hypothetical protein AQ_328; structural genomics, 83.5
3fes_A145 ATP-dependent CLP endopeptidase; alpha-helical bun 83.09
3fh2_A146 Probable ATP-dependent protease (heat shock prote; 83.05
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
Probab=100.00  E-value=2.1e-46  Score=274.23  Aligned_cols=110  Identities=54%  Similarity=0.842  Sum_probs=104.8

Q ss_pred             CCCCCCcccccCcccchhhhhhhhhhccccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHhcCCceechhhHHHHhhC
Q 032642           25 KKRPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRG  104 (136)
Q Consensus        25 ~~~~~s~SsragL~fPVsrv~R~Lk~~~~a~~RVs~~A~VyLaAvLEyL~~EILelAg~~A~~~~~krItp~hI~~AI~n  104 (136)
                      +++.+|+|+|+||||||+||+|||++++|++ ||+++|+|||+||||||++||+|+|+|+|+++++++|+|+||++||+|
T Consensus         9 ~~~~~srs~ragLqfPV~ri~R~Lk~~~~a~-RV~~~A~VyLaAvLEyL~aEIlelAgn~A~~~k~~rItp~hi~lAI~n   87 (120)
T 2f8n_G            9 KSTKTSRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAVNAARDNKKGRVTPRHILLAVAN   87 (120)
T ss_dssp             -CCCCCHHHHHTCSSCHHHHHHHHHHHSSSC-EECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHT
T ss_pred             CcCCcCcccccCccCChHHHHHHHHcCcccc-ccccchHHHHHHHHHHHHHHHHHHHHHHHhhcCCceEcHHHHHHHHhc
Confidence            5567899999999999999999999999997 999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHhhhhc-cccCCCccCCcccccccccCC
Q 032642          105 DEELDTLIKG-TIAGGGVIPHIHKSLINKTTK  135 (136)
Q Consensus       105 D~EL~~Lf~~-~ia~ggv~p~i~~~~~~~~~~  135 (136)
                      |+||++||++ ||++|||+|+||++|+||+.+
T Consensus        88 DeEL~~Ll~~vtia~ggv~p~i~~~l~~k~~~  119 (120)
T 2f8n_G           88 DEELNQLLKGVTIASGGVLPNIHPELLAKKRG  119 (120)
T ss_dssp             SHHHHHHTTTEEETTCCCCCCCCGGGSCCC--
T ss_pred             CHHHHHHhCCceECCCCcCCCcCHHHcCCccC
Confidence            9999999999 999999999999999999865



>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A Back     alignment and structure
>1k6k_A ATP-dependent CLP protease ATP-binding subunit CLPA; chaperone, ATPase, adaptor binding, X-RAY, structure, N-domain, hydrolase; 1.80A {Escherichia coli} SCOP: a.174.1.1 PDB: 1r6c_X 1r6o_A* 1r6q_A* 1mg9_B* 1lzw_B* 1mbx_A* 1mbv_A 1mbu_A* Back     alignment and structure
>2y1q_A CLPC N-domain, negative regulator of genetic competence CLPC/MEC; transcription, proteolysis; 1.50A {Bacillus subtilis} PDB: 2y1r_A* 2k77_A Back     alignment and structure
>1khy_A CLPB protein; alpha helix, chaperone; 1.95A {Escherichia coli} SCOP: a.174.1.1 Back     alignment and structure
>1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 Back     alignment and structure
>3fes_A ATP-dependent CLP endopeptidase; alpha-helical bundles, structural genomics, PSI-2, protein S initiative; HET: PG4 EPE; 1.82A {Clostridium difficile} Back     alignment and structure
>3fh2_A Probable ATP-dependent protease (heat shock prote; struct genomics, PSI2, MCSG, protein structure initiative; 1.60A {Corynebacterium glutamicum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1u35c1106 a.22.1.1 (C:814-919) macro-H2A.1, histone domain { 2e-49
d1f66c_103 a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), v 2e-48
d1tzya_106 a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus) 7e-48
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 2e-35
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 7e-17
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 1e-16
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 8e-10
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 9e-06
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 0.002
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: macro-H2A.1, histone domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  151 bits (383), Expect = 2e-49
 Identities = 58/104 (55%), Positives = 80/104 (76%), Gaps = 2/104 (1%)

Query: 30  SRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLK 89
           SRS++AG+ FPVGR+ R++K     + R+G  A VY+A++LEYLTAE+LELA NA++D K
Sbjct: 3   SRSAKAGVIFPVGRMLRYIKKGHPKY-RIGVGAPVYMAAVLEYLTAEILELAVNAARDNK 61

Query: 90  VKRITPRHLQLAIRGDEELDTLIKG-TIAGGGVIPHIHKSLINK 132
             R+TPRH+ LA+  DEEL+ L+KG TIA GGV+P+IH  L+ K
Sbjct: 62  KGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAK 105


>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 106 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 100.0
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 100.0
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 100.0
d1q9ca_172 Histone domain of Son of sevenless protein {Human 99.96
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.66
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.55
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.42
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.25
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.24
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 99.08
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.95
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 98.81
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 98.72
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 98.61
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 98.57
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 97.57
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 97.54
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 97.23
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 96.7
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 96.39
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 94.38
d1k6ka_142 N-terminal, ClpS-binding domain of ClpA, an Hsp100 92.0
d1wwia1148 Hypothetical protein TTHA1479 {Thermus thermophilu 91.05
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 89.69
d1qvra1145 N-terminal domain of ClpB (heat shock protein F84. 89.02
d1khya_139 N-terminal domain of ClpB (heat shock protein F84. 88.32
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 81.8
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H2A
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00  E-value=2.1e-46  Score=267.27  Aligned_cols=105  Identities=65%  Similarity=0.958  Sum_probs=102.5

Q ss_pred             CCCCcccccCcccchhhhhhhhhhccccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHhcCCceechhhHHHHhhCCh
Q 032642           27 RPISRSSRAGIQFPVGRIHRHLKSRIAAHGRVGATAAVYLASILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDE  106 (136)
Q Consensus        27 ~~~s~SsragL~fPVsrv~R~Lk~~~~a~~RVs~~A~VyLaAvLEyL~~EILelAg~~A~~~~~krItp~hI~~AI~nD~  106 (136)
                      +.+|+|+||||||||+||+|+|++++|++ ||+++|||||+||||||++||||+|+|+|+++++++|+|+||++||+||+
T Consensus         1 k~~Srs~rAgL~FpV~rv~r~Lk~~~~~~-rv~~~apVylaAVLEYLtaEiLELAgn~a~~~k~~rItPrhi~lAirnDe   79 (106)
T d1tzya_           1 KAKSRSSRAGLQFPVGRVHRLLRKGNYAE-RVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDE   79 (106)
T ss_dssp             CCCCHHHHHTCSSCHHHHHHHHHHTTSSS-EECTHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHTSH
T ss_pred             CCccccccCCccCChHHHHHHHHcCcccc-ccCCCchHHHHHHHHHHHHHHHHHhhHHHHhcCCceecchhhhhcccCHH
Confidence            46899999999999999999999999987 99999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhhc-cccCCCccCCcccccccc
Q 032642          107 ELDTLIKG-TIAGGGVIPHIHKSLINK  132 (136)
Q Consensus       107 EL~~Lf~~-~ia~ggv~p~i~~~~~~~  132 (136)
                      ||++||.+ ||++|||+|+||++|+||
T Consensus        80 eL~~L~~~vtI~~GGv~P~Ih~~Llpk  106 (106)
T d1tzya_          80 ELNKLLGKVTIAQGGVLPNIQAVLLPK  106 (106)
T ss_dssp             HHHHHTTTEEETTCCCCCCCCGGGSCC
T ss_pred             HHHHHHcCCeecCCCccCccCHhhcCC
Confidence            99999999 999999999999999987



>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k6ka_ a.174.1.1 (A:) N-terminal, ClpS-binding domain of ClpA, an Hsp100 chaperone {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qvra1 a.174.1.1 (A:4-148) N-terminal domain of ClpB (heat shock protein F84.1) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1khya_ a.174.1.1 (A:) N-terminal domain of ClpB (heat shock protein F84.1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure