Citrus Sinensis ID: 032681
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| 413953368 | 227 | histone H3 [Zea mays] | 1.0 | 0.599 | 1.0 | 2e-72 | |
| 413937382 | 171 | histone H3, partial [Zea mays] | 1.0 | 0.795 | 1.0 | 5e-72 | |
| 145334271 | 164 | histone H3 [Arabidopsis thaliana] gi|332 | 1.0 | 0.829 | 1.0 | 6e-72 | |
| 357476499 | 391 | Histone H3 [Medicago truncatula] gi|3555 | 1.0 | 0.347 | 1.0 | 8e-72 | |
| 296083584 | 147 | unnamed protein product [Vitis vinifera] | 1.0 | 0.925 | 1.0 | 8e-72 | |
| 414867092 | 165 | TPA: histone H3 [Zea mays] | 1.0 | 0.824 | 1.0 | 8e-72 | |
| 147826736 | 137 | hypothetical protein VITISV_010022 [Viti | 1.0 | 0.992 | 1.0 | 8e-72 | |
| 15236103 | 136 | histone H3 [Arabidopsis thaliana] gi|152 | 1.0 | 1.0 | 1.0 | 1e-71 | |
| 195606516 | 161 | histone H3 [Zea mays] | 1.0 | 0.844 | 0.992 | 1e-71 | |
| 195658747 | 136 | histone H3 [Zea mays] | 1.0 | 1.0 | 0.992 | 2e-71 |
| >gi|413953368|gb|AFW86017.1| histone H3 [Zea mays] | Back alignment and taxonomy information |
|---|
Score = 276 bits (706), Expect = 2e-72, Method: Compositional matrix adjust.
Identities = 136/136 (100%), Positives = 136/136 (100%)
Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
Sbjct: 92 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 151
Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 152 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 211
Query: 121 MPKDIQLARRIRGERA 136
MPKDIQLARRIRGERA
Sbjct: 212 MPKDIQLARRIRGERA 227
|
Source: Zea mays Species: Zea mays Genus: Zea Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|413937382|gb|AFW71933.1| histone H3, partial [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|145334271|ref|NP_001078516.1| histone H3 [Arabidopsis thaliana] gi|332661756|gb|AEE87156.1| histone H3 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357476499|ref|XP_003608535.1| Histone H3 [Medicago truncatula] gi|355509590|gb|AES90732.1| Histone H3 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|296083584|emb|CBI23573.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|414867092|tpg|DAA45649.1| TPA: histone H3 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|147826736|emb|CAN70652.1| hypothetical protein VITISV_010022 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15236103|ref|NP_195713.1| histone H3 [Arabidopsis thaliana] gi|15238916|ref|NP_196659.1| histone H3 [Arabidopsis thaliana] gi|30692585|ref|NP_849529.1| histone H3 [Arabidopsis thaliana] gi|79326608|ref|NP_001031816.1| histone H3 [Arabidopsis thaliana] gi|115453351|ref|NP_001050276.1| Os03g0390600 [Oryza sativa Japonica Group] gi|115466188|ref|NP_001056693.1| Os06g0130900 [Oryza sativa Japonica Group] gi|145334273|ref|NP_001078517.1| histone H3 [Arabidopsis thaliana] gi|212721898|ref|NP_001131417.1| uncharacterized protein LOC100192746 [Zea mays] gi|350535881|ref|NP_001234218.1| histone H3 variant H3.3 [Solanum lycopersicum] gi|351724645|ref|NP_001235785.1| uncharacterized protein LOC100305466 [Glycine max] gi|167998945|ref|XP_001752178.1| histone H3 [Physcomitrella patens subsp. patens] gi|167999057|ref|XP_001752234.1| histone H3 [Physcomitrella patens subsp. patens] gi|167999225|ref|XP_001752318.1| histone H3 [Physcomitrella patens subsp. patens] gi|224062043|ref|XP_002300726.1| histone H3 [Populus trichocarpa] gi|224066983|ref|XP_002302311.1| histone H3 [Populus trichocarpa] gi|224081102|ref|XP_002306294.1| histone H3 [Populus trichocarpa] gi|224085804|ref|XP_002307702.1| histone H3 [Populus trichocarpa] gi|224093720|ref|XP_002309961.1| histone H3 [Populus trichocarpa] gi|224097140|ref|XP_002310848.1| histone H3 [Populus trichocarpa] gi|225431185|ref|XP_002270349.1| PREDICTED: histone H3.3-like [Vitis vinifera] gi|225458071|ref|XP_002278857.1| PREDICTED: histone H3.3-like isoform 3 [Vitis vinifera] gi|225458073|ref|XP_002278809.1| PREDICTED: histone H3.3-like isoform 1 [Vitis vinifera] gi|225458075|ref|XP_002278833.1| PREDICTED: histone H3.3-like isoform 2 [Vitis vinifera] gi|242040731|ref|XP_002467760.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor] gi|242094532|ref|XP_002437756.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor] gi|255538848|ref|XP_002510489.1| histone h3, putative [Ricinus communis] gi|255538850|ref|XP_002510490.1| histone h3, putative [Ricinus communis] gi|255545798|ref|XP_002513959.1| histone h3, putative [Ricinus communis] gi|255581420|ref|XP_002531518.1| histone h3, putative [Ricinus communis] gi|297811211|ref|XP_002873489.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] gi|302792052|ref|XP_002977792.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] gi|302810438|ref|XP_002986910.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] gi|356540261|ref|XP_003538608.1| PREDICTED: histone H3.3-like isoform 1 [Glycine max] gi|356540263|ref|XP_003538609.1| PREDICTED: histone H3.3-like isoform 2 [Glycine max] gi|356540265|ref|XP_003538610.1| PREDICTED: histone H3.3-like isoform 3 [Glycine max] gi|356540267|ref|XP_003538611.1| PREDICTED: histone H3.3-like [Glycine max] gi|356553405|ref|XP_003545047.1| PREDICTED: histone H3.3-like [Glycine max] gi|356564335|ref|XP_003550410.1| PREDICTED: histone H3.3-like [Glycine max] gi|356567640|ref|XP_003552025.1| PREDICTED: histone H3.3-like [Glycine max] gi|357110653|ref|XP_003557131.1| PREDICTED: histone H3.3-like [Brachypodium distachyon] gi|357110657|ref|XP_003557133.1| PREDICTED: histone H3.3-like [Brachypodium distachyon] gi|357163855|ref|XP_003579868.1| PREDICTED: histone H3.3-like isoform 1 [Brachypodium distachyon] gi|357163858|ref|XP_003579869.1| PREDICTED: histone H3.3-like isoform 2 [Brachypodium distachyon] gi|357438217|ref|XP_003589384.1| Histone H3 [Medicago truncatula] gi|357516543|ref|XP_003628560.1| Histone H3 [Medicago truncatula] gi|359480475|ref|XP_003632470.1| PREDICTED: histone H3.3 isoform 1 [Vitis vinifera] gi|359480477|ref|XP_003632471.1| PREDICTED: histone H3.3 isoform 2 [Vitis vinifera] gi|359480479|ref|XP_003632472.1| PREDICTED: histone H3.3 isoform 3 [Vitis vinifera] gi|359480481|ref|XP_003632473.1| PREDICTED: histone H3.3 isoform 4 [Vitis vinifera] gi|359480483|ref|XP_003632474.1| PREDICTED: histone H3.3 isoform 5 [Vitis vinifera] gi|359497883|ref|XP_003635681.1| PREDICTED: histone H3.3-like [Vitis vinifera] gi|449458279|ref|XP_004146875.1| PREDICTED: histone H3.3-like [Cucumis sativus] gi|449469837|ref|XP_004152625.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus] gi|449469839|ref|XP_004152626.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus] gi|449503915|ref|XP_004162225.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus] gi|449503917|ref|XP_004162226.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus] gi|449522454|ref|XP_004168241.1| PREDICTED: histone H3.3-like [Cucumis sativus] gi|27734400|sp|P59169.2|H33_ARATH RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 gi|54035960|sp|Q71V89.3|H33_GOSHI RecName: Full=Histone H3.3 gi|59799551|sp|P69245.2|H33_LOLTE RecName: Full=Histone H3.3 gi|59799580|sp|P69244.2|H33_MEDSA RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: Full=Minor histone H3 gi|73919839|sp|Q71H73.3|H33_VITVI RecName: Full=Histone H3.3 gi|73919913|sp|Q6RUR1.3|H33_CAPAN RecName: Full=Histone H3.3 gi|73919918|sp|Q71U98.3|H33_ORYCO RecName: Full=Histone H3.3 gi|73919919|sp|Q711T2.3|H33_PINPS RecName: Full=Histone H3.3 gi|75138729|sp|Q76N23.1|H33_TOBAC RecName: Full=Histone H3.3 gi|119370648|sp|Q3C2E5.3|H33_LOLMU RecName: Full=Histone H3.3; AltName: Full=Replacement histone H3 gi|158512877|sp|A2XHJ3.1|H33_ORYSI RecName: Full=Histone H3.3; AltName: Full=H3.2 gi|158564092|sp|Q0JCT1.2|H33_ORYSJ RecName: Full=Histone H3.3; AltName: Full=H3.2 gi|14326562|gb|AAK60325.1|AF385735_1 AT4g40030/T5J17_200 [Arabidopsis thaliana] gi|16324|emb|CAA42957.1| histone H3.3 like protein [Arabidopsis thaliana] gi|404825|emb|CAA42958.1| histone H3.3 like protein [Arabidopsis thaliana] gi|488563|gb|AAB49538.1| histone H3.2 [Medicago sativa] gi|488567|gb|AAB36493.1| histone H3.2 [Medicago sativa] gi|488569|gb|AAB36494.1| histone H3.2 [Medicago sativa] gi|488575|gb|AAB36497.1| histone H3.2 [Medicago sativa] gi|488577|gb|AAB36498.1| histone H3.2 [Medicago sativa] gi|510911|emb|CAA56153.1| histone H3 [Lolium temulentum] gi|1435157|emb|CAA58445.1| histone H3 variant H3.3 [Solanum lycopersicum] gi|2558944|gb|AAB97162.1| histone 3 [Gossypium hirsutum] gi|3273350|dbj|BAA31218.1| histone H3 [Nicotiana tabacum] gi|3885890|gb|AAC78105.1| histone H3 [Oryza sativa Japonica Group] gi|4038469|gb|AAC97380.1| histone H3 [Oryza coarctata] gi|4490754|emb|CAB38916.1| histone H3.3 [Arabidopsis thaliana] gi|4490755|emb|CAB38917.1| Histon H3 [Arabidopsis thaliana] gi|6006364|dbj|BAA84794.1| histone H3 [Oryza sativa Japonica Group] gi|7271058|emb|CAB80666.1| histone H3.3 [Arabidopsis thaliana] gi|7271059|emb|CAB80667.1| Histon H3 [Arabidopsis thaliana] gi|8979732|emb|CAB96853.1| histon H3 protein [Arabidopsis thaliana] gi|17979505|gb|AAL50088.1| AT5g10980/T30N20_250 [Arabidopsis thaliana] gi|18700236|gb|AAL77728.1| AT4g40030/T5J17_200 [Arabidopsis thaliana] gi|20453305|gb|AAM19891.1| AT5g10980/T30N20_250 [Arabidopsis thaliana] gi|21554902|gb|AAM63725.1| histon H3 protein [Arabidopsis thaliana] gi|27311571|gb|AAO00751.1| Histon H3 [Arabidopsis thaliana] gi|28058719|gb|AAO29945.1| Histone H3 [Arabidopsis thaliana] gi|30024114|emb|CAC84678.1| putative histone H3 [Pinus pinaster] gi|30315015|gb|AAP30739.1| histone H3.3 [Vitis vinifera] gi|37991915|gb|AAR06361.1| histone H3.2 protein [Oryza sativa Japonica Group] gi|40353325|gb|AAR84425.1| histone H3-like protein [Capsicum annuum] gi|42541263|gb|AAS19511.1| putative histone H3 [Oryza sativa Japonica Group] gi|62642117|gb|AAX92697.1| histone 3 [Picea abies] gi|72398499|gb|AAZ72655.1| histone H3.1 [Craterostigma plantagineum] gi|72398501|gb|AAZ72656.1| histone H3.2 [Craterostigma plantagineum] gi|78210733|dbj|BAE47073.1| replacement histone H3 [Lolium multiflorum] gi|98960867|gb|ABF58917.1| At4g40040 [Arabidopsis thaliana] gi|106879571|emb|CAJ38369.1| histin H3 [Plantago major] gi|108708563|gb|ABF96358.1| Histone H3, putative, expressed [Oryza sativa Japonica Group] gi|108708564|gb|ABF96359.1| Histone H3, putative, expressed [Oryza sativa Japonica Group] gi|113548747|dbj|BAF12190.1| Os03g0390600 [Oryza sativa Japonica Group] gi|113594733|dbj|BAF18607.1| Os06g0130900 [Oryza sativa Japonica Group] gi|115394199|gb|ABI97039.1| histone H3 [Robinia pseudoacacia] gi|116310084|emb|CAH67105.1| H0818E04.22 [Oryza sativa Indica Group] gi|116310167|emb|CAH67180.1| H0815C01.1 [Oryza sativa Indica Group] gi|116779721|gb|ABK21404.1| unknown [Picea sitchensis] gi|116780910|gb|ABK21875.1| unknown [Picea sitchensis] gi|116783574|gb|ABK23002.1| unknown [Picea sitchensis] gi|116785270|gb|ABK23658.1| unknown [Picea sitchensis] gi|118485336|gb|ABK94527.1| unknown [Populus trichocarpa] gi|118485551|gb|ABK94627.1| unknown [Populus trichocarpa] gi|118485975|gb|ABK94832.1| unknown [Populus trichocarpa] gi|118489220|gb|ABK96416.1| unknown [Populus trichocarpa x Populus deltoides] gi|125544164|gb|EAY90303.1| hypothetical protein OsI_11878 [Oryza sativa Indica Group] gi|125590565|gb|EAZ30915.1| hypothetical protein OsJ_14996 [Oryza sativa Japonica Group] gi|125595930|gb|EAZ35710.1| hypothetical protein OsJ_19999 [Oryza sativa Japonica Group] gi|144953503|gb|ABP04114.1| histone 3 [Lemna minor] gi|147802094|emb|CAN70615.1| hypothetical protein VITISV_004842 [Vitis vinifera] gi|147856024|emb|CAN80736.1| hypothetical protein VITISV_034858 [Vitis vinifera] gi|147866150|emb|CAN81972.1| hypothetical protein VITISV_011984 [Vitis vinifera] gi|148905756|gb|ABR16042.1| unknown [Picea sitchensis] gi|148906054|gb|ABR16186.1| unknown [Picea sitchensis] gi|148907045|gb|ABR16666.1| unknown [Picea sitchensis] gi|148907691|gb|ABR16974.1| unknown [Picea sitchensis] gi|148907720|gb|ABR16987.1| unknown [Picea sitchensis] gi|148907797|gb|ABR17024.1| unknown [Picea sitchensis] gi|148910628|gb|ABR18384.1| unknown [Picea sitchensis] gi|151413347|gb|ABS11142.1| histone H3 [Solanum lycopersicum] gi|154550671|gb|ABS83501.1| U box domain-containing protein [Oryza sativa Japonica Group] gi|162696573|gb|EDQ82911.1| histone H3 [Physcomitrella patens subsp. patens] gi|162696629|gb|EDQ82967.1| histone H3 [Physcomitrella patens subsp. patens] gi|162696713|gb|EDQ83051.1| histone H3 [Physcomitrella patens subsp. patens] gi|169244475|gb|ACA50511.1| histone H3 [Oryza sativa Japonica Group] gi|192910840|gb|ACF06528.1| histone H3 [Elaeis guineensis] gi|192910874|gb|ACF06545.1| histone H3 [Elaeis guineensis] gi|194691462|gb|ACF79815.1| unknown [Zea mays] gi|194706414|gb|ACF87291.1| unknown [Zea mays] gi|194708778|gb|ACF88473.1| unknown [Zea mays] gi|195605410|gb|ACG24535.1| histone H3 [Zea mays] gi|195606204|gb|ACG24932.1| histone H3 [Zea mays] gi|195606344|gb|ACG25002.1| histone H3 [Zea mays] gi|195607550|gb|ACG25605.1| histone H3 [Zea mays] gi|195618422|gb|ACG31041.1| histone H3 [Zea mays] gi|195618436|gb|ACG31048.1| histone H3 [Zea mays] gi|195653337|gb|ACG46136.1| histone H3 [Zea mays] gi|215693207|dbj|BAG88589.1| unnamed protein product [Oryza sativa Japonica Group] gi|215740862|dbj|BAG97018.1| unnamed protein product [Oryza sativa Japonica Group] gi|218194947|gb|EEC77374.1| hypothetical protein OsI_16104 [Oryza sativa Indica Group] gi|222423947|dbj|BAH19936.1| AT4G40040 [Arabidopsis thaliana] gi|222424399|dbj|BAH20155.1| AT4G40040 [Arabidopsis thaliana] gi|222625050|gb|EEE59182.1| hypothetical protein OsJ_11116 [Oryza sativa Japonica Group] gi|222842452|gb|EEE79999.1| histone H3 [Populus trichocarpa] gi|222844037|gb|EEE81584.1| histone H3 [Populus trichocarpa] gi|222852864|gb|EEE90411.1| histone H3 [Populus trichocarpa] gi|222853751|gb|EEE91298.1| histone H3 [Populus trichocarpa] gi|222855743|gb|EEE93290.1| histone H3 [Populus trichocarpa] gi|222857151|gb|EEE94698.1| histone H3 [Populus trichocarpa] gi|223528871|gb|EEF30872.1| histone h3, putative [Ricinus communis] gi|223547045|gb|EEF48542.1| histone h3, putative [Ricinus communis] gi|223551190|gb|EEF52676.1| histone h3, putative [Ricinus communis] gi|223551191|gb|EEF52677.1| histone h3, putative [Ricinus communis] gi|224284828|gb|ACN40144.1| unknown [Picea sitchensis] gi|224286639|gb|ACN41024.1| unknown [Picea sitchensis] gi|224814382|gb|ACN65412.1| histone 3.2 [Pteris vittata] gi|238013324|gb|ACR37697.1| unknown [Zea mays] gi|241915979|gb|EER89123.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor] gi|241921614|gb|EER94758.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor] gi|255625589|gb|ACU13139.1| unknown [Glycine max] gi|294464776|gb|ADE77894.1| unknown [Picea sitchensis] gi|295002522|gb|ADF59039.1| histone H3.2 [Jatropha curcas] gi|297319326|gb|EFH49748.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] gi|297735036|emb|CBI17398.3| unnamed protein product [Vitis vinifera] gi|297741830|emb|CBI33143.3| unnamed protein product [Vitis vinifera] gi|298569751|gb|ADI87404.1| histone H3 [Oryza sativa] gi|298569753|gb|ADI87405.1| histone H3 [Oryza sativa] gi|298569757|gb|ADI87407.1| histone H3 [Oryza sativa] gi|300145315|gb|EFJ11992.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] gi|300154495|gb|EFJ21130.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] gi|302142605|emb|CBI19808.3| unnamed protein product [Vitis vinifera] gi|312985289|gb|ADR30795.1| histone H3.2 [Hevea brasiliensis] gi|319903990|gb|ADV77197.1| histone H3 [Cladophora coelothrix] gi|326503682|dbj|BAJ86347.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326504688|dbj|BAK06635.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326511152|dbj|BAJ87590.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|332004234|gb|AED91617.1| histone H3 [Arabidopsis thaliana] gi|332661755|gb|AEE87155.1| histone H3 [Arabidopsis thaliana] gi|332661757|gb|AEE87157.1| histone H3 [Arabidopsis thaliana] gi|332661758|gb|AEE87158.1| histone H3 [Arabidopsis thaliana] gi|332661759|gb|AEE87159.1| histone H3 [Arabidopsis thaliana] gi|354720970|dbj|BAL04972.1| histone H3 [Zoysia japonica] gi|355478432|gb|AES59635.1| Histone H3 [Medicago truncatula] gi|355522582|gb|AET03036.1| Histone H3 [Medicago truncatula] gi|374434006|gb|AEZ52395.1| histone H3 [Wolffia australiana] gi|379054876|gb|AFC88829.1| histone H23-like protein, partial [Miscanthus sinensis] gi|388490700|gb|AFK33416.1| unknown [Lotus japonicus] gi|388501438|gb|AFK38785.1| unknown [Medicago truncatula] gi|390633860|gb|AFM30053.1| histone H3 [Chimonanthus praecox] gi|399525606|gb|AFP44115.1| histone H3 [Lycoris longituba] gi|403081499|gb|AFR23066.1| hypothetical protein [Oryza sativa] gi|413937383|gb|AFW71934.1| histone H3 isoform 1 [Zea mays] gi|413937384|gb|AFW71935.1| histone H3 isoform 2 [Zea mays] gi|413937385|gb|AFW71936.1| histone H3 isoform 3 [Zea mays] gi|413942741|gb|AFW75390.1| histone H3 [Zea mays] gi|413953369|gb|AFW86018.1| histone H3 [Zea mays] gi|414867094|tpg|DAA45651.1| TPA: histone H3 isoform 1 [Zea mays] gi|414867095|tpg|DAA45652.1| TPA: histone H3 isoform 2 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|195606516|gb|ACG25088.1| histone H3 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|195658747|gb|ACG48841.1| histone H3 [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 136 | ||||||
| TAIR|locus:2140010 | 164 | H3.3 "histone 3.3" [Arabidopsi | 1.0 | 0.829 | 1.0 | 8.2e-67 | |
| TAIR|locus:2183795 | 136 | H3.3 "histone 3.3" [Arabidopsi | 1.0 | 1.0 | 1.0 | 8.2e-67 | |
| TAIR|locus:2140025 | 136 | H3.3 "histone 3.3" [Arabidopsi | 1.0 | 1.0 | 1.0 | 8.2e-67 | |
| FB|FBgn0051613 | 136 | His3:CG31613 "His3:CG31613" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053803 | 136 | His3:CG33803 "His3:CG33803" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053806 | 136 | His3:CG33806 "His3:CG33806" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053809 | 136 | His3:CG33809 "His3:CG33809" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053812 | 136 | His3:CG33812 "His3:CG33812" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053815 | 136 | His3:CG33815 "His3:CG33815" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 | |
| FB|FBgn0053818 | 136 | His3:CG33818 "His3:CG33818" [D | 1.0 | 1.0 | 0.963 | 1.8e-64 |
| TAIR|locus:2140010 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
Identities = 136/136 (100%), Positives = 136/136 (100%)
Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
Sbjct: 29 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 88
Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 89 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 148
Query: 121 MPKDIQLARRIRGERA 136
MPKDIQLARRIRGERA
Sbjct: 149 MPKDIQLARRIRGERA 164
|
|
| TAIR|locus:2183795 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2140025 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| PTZ00018 | 136 | PTZ00018, PTZ00018, histone H3; Provisional | 5e-84 | |
| PLN00121 | 136 | PLN00121, PLN00121, histone H3; Provisional | 5e-76 | |
| smart00428 | 105 | smart00428, H3, Histone H3 | 4e-57 | |
| PLN00161 | 135 | PLN00161, PLN00161, histone H3; Provisional | 4e-44 | |
| PLN00160 | 97 | PLN00160, PLN00160, histone H3; Provisional | 1e-36 | |
| pfam00125 | 75 | pfam00125, Histone, Core histone H2A/H2B/H3/H4 | 1e-30 | |
| COG2036 | 91 | COG2036, HHT1, Histones H3 and H4 [Chromatin struc | 8e-28 |
| >gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional | Back alignment and domain information |
|---|
Score = 241 bits (617), Expect = 5e-84
Identities = 130/136 (95%), Positives = 134/136 (98%)
Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIR+YQKSTE
Sbjct: 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60
Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
LLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
Query: 121 MPKDIQLARRIRGERA 136
MPKDIQLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136
|
Length = 136 |
| >gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|128705 smart00428, H3, Histone H3 | Back alignment and domain information |
|---|
| >gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 | Back alignment and domain information |
|---|
| >gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| PTZ00018 | 136 | histone H3; Provisional | 100.0 | |
| PLN00121 | 136 | histone H3; Provisional | 100.0 | |
| PLN00161 | 135 | histone H3; Provisional | 100.0 | |
| KOG1745 | 137 | consensus Histones H3 and H4 [Chromatin structure | 100.0 | |
| smart00428 | 105 | H3 Histone H3. | 100.0 | |
| PLN00160 | 97 | histone H3; Provisional | 100.0 | |
| COG2036 | 91 | HHT1 Histones H3 and H4 [Chromatin structure and d | 99.94 | |
| PF00125 | 75 | Histone: Core histone H2A/H2B/H3/H4 histone h2a si | 99.84 | |
| cd07981 | 72 | TAF12 TATA Binding Protein (TBP) Associated Factor | 99.43 | |
| cd00076 | 85 | H4 Histone H4, one of the four histones, along wit | 99.33 | |
| PLN00035 | 103 | histone H4; Provisional | 99.3 | |
| PTZ00015 | 102 | histone H4; Provisional | 99.28 | |
| smart00803 | 65 | TAF TATA box binding protein associated factor. TA | 99.22 | |
| smart00417 | 74 | H4 Histone H4. | 99.14 | |
| PTZ00463 | 117 | histone H2B; Provisional | 99.01 | |
| PLN00158 | 116 | histone H2B; Provisional | 99.0 | |
| smart00427 | 89 | H2B Histone H2B. | 98.99 | |
| cd07979 | 117 | TAF9 TATA Binding Protein (TBP) Associated Factor | 98.83 | |
| PF00808 | 65 | CBFD_NFYB_HMF: Histone-like transcription factor ( | 98.76 | |
| KOG1744 | 127 | consensus Histone H2B [Chromatin structure and dyn | 98.61 | |
| cd00074 | 115 | H2A Histone 2A; H2A is a subunit of the nucleosome | 98.39 | |
| smart00576 | 77 | BTP Bromodomain transcription factors and PHD doma | 98.36 | |
| PF15630 | 76 | CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C | 98.29 | |
| KOG0870 | 172 | consensus DNA polymerase epsilon, subunit D [Trans | 98.28 | |
| PF03847 | 68 | TFIID_20kDa: Transcription initiation factor TFIID | 98.24 | |
| cd08050 | 343 | TAF6 TATA Binding Protein (TBP) Associated Factor | 98.17 | |
| PF02969 | 66 | TAF: TATA box binding protein associated factor (T | 98.06 | |
| PF02291 | 129 | TFIID-31kDa: Transcription initiation factor IID, | 97.94 | |
| PF15511 | 414 | CENP-T: Centromere kinetochore component CENP-T; P | 97.89 | |
| KOG1142 | 258 | consensus Transcription initiation factor TFIID, s | 97.7 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 97.35 | |
| KOG3334 | 148 | consensus Transcription initiation factor TFIID, s | 97.13 | |
| KOG3467 | 103 | consensus Histone H4 [Chromatin structure and dyna | 96.96 | |
| PF07524 | 77 | Bromo_TP: Bromodomain associated; InterPro: IPR006 | 96.83 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 96.39 | |
| PLN00154 | 136 | histone H2A; Provisional | 95.67 | |
| smart00414 | 106 | H2A Histone 2A. | 95.67 | |
| PTZ00017 | 134 | histone H2A; Provisional | 95.41 | |
| COG5262 | 132 | HTA1 Histone H2A [Chromatin structure and dynamics | 94.84 | |
| KOG2549 | 576 | consensus Transcription initiation factor TFIID, s | 94.47 | |
| PF02269 | 93 | TFIID-18kDa: Transcription initiation factor IID, | 94.38 | |
| PLN00156 | 139 | histone H2AX; Provisional | 94.25 | |
| PLN00157 | 132 | histone H2A; Provisional | 94.23 | |
| PLN00153 | 129 | histone H2A; Provisional | 93.85 | |
| COG5094 | 145 | TAF9 Transcription initiation factor TFIID, subuni | 93.25 | |
| PTZ00252 | 134 | histone H2A; Provisional | 93.05 | |
| COG5150 | 148 | Class 2 transcription repressor NC2, beta subunit | 92.99 | |
| KOG1756 | 131 | consensus Histone 2A [Chromatin structure and dyna | 91.39 | |
| COG5208 | 286 | HAP5 CCAAT-binding factor, subunit C [Transcriptio | 91.25 | |
| cd08045 | 212 | TAF4 TATA Binding Protein (TBP) Associated Factor | 91.16 | |
| cd07978 | 92 | TAF13 The TATA Binding Protein (TBP) Associated Fa | 90.16 | |
| KOG4336 | 323 | consensus TBP-associated transcription factor Prod | 89.57 | |
| PF05236 | 264 | TAF4: Transcription initiation factor TFIID compon | 89.45 | |
| KOG1657 | 236 | consensus CCAAT-binding factor, subunit C (HAP5) [ | 86.7 | |
| PF09415 | 72 | CENP-X: CENP-S associating Centromere protein X; I | 84.82 | |
| PF09123 | 138 | DUF1931: Domain of unknown function (DUF1931); Int | 80.38 | |
| COG5248 | 126 | TAF19 Transcription initiation factor TFIID, subun | 80.04 |
| >PTZ00018 histone H3; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-56 Score=329.89 Aligned_cols=135 Identities=96% Similarity=1.337 Sum_probs=129.8
Q ss_pred CCcccccccccCCCCCCCcchhhhhcccCCCCCCCCCCCcccCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhh
Q 032681 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK 80 (136)
Q Consensus 1 Martk~~a~ks~g~kap~k~~~~k~~~~~~p~~~~~~k~~r~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~ 80 (136)
|||||+++++++|+++|+++.++++..++.+..++.++++||+||+++|+|||+||+||+||||++||+|||+||++++.
T Consensus 1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~ 80 (136)
T PTZ00018 1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80 (136)
T ss_pred CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence 99999999999999999999988877777777778889999999999999999999999999999999999999999999
Q ss_pred ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccChhhHHHHHHHhccc
Q 032681 81 TDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 135 (136)
Q Consensus 81 ~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~~kDiqla~rir~~~ 135 (136)
.++||+++||++||||+|+|||+||||+|+||+||||||||++||+|+.+|||++
T Consensus 81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~kD~~L~~rirg~~ 135 (136)
T PTZ00018 81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 135 (136)
T ss_pred CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchhhHHHHHHhcccC
Confidence 9999999999999999999999999999999999999999999999999999986
|
|
| >PLN00121 histone H3; Provisional | Back alignment and domain information |
|---|
| >PLN00161 histone H3; Provisional | Back alignment and domain information |
|---|
| >KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >smart00428 H3 Histone H3 | Back alignment and domain information |
|---|
| >PLN00160 histone H3; Provisional | Back alignment and domain information |
|---|
| >COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] | Back alignment and domain information |
|---|
| >cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution | Back alignment and domain information |
|---|
| >PLN00035 histone H4; Provisional | Back alignment and domain information |
|---|
| >PTZ00015 histone H4; Provisional | Back alignment and domain information |
|---|
| >smart00803 TAF TATA box binding protein associated factor | Back alignment and domain information |
|---|
| >smart00417 H4 Histone H4 | Back alignment and domain information |
|---|
| >PTZ00463 histone H2B; Provisional | Back alignment and domain information |
|---|
| >PLN00158 histone H2B; Provisional | Back alignment and domain information |
|---|
| >smart00427 H2B Histone H2B | Back alignment and domain information |
|---|
| >cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin | Back alignment and domain information |
|---|
| >KOG1744 consensus Histone H2B [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome | Back alignment and domain information |
|---|
| >smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins | Back alignment and domain information |
|---|
| >PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C | Back alignment and domain information |
|---|
| >KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] | Back alignment and domain information |
|---|
| >PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex | Back alignment and domain information |
|---|
| >PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] | Back alignment and domain information |
|---|
| >PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T | Back alignment and domain information |
|---|
| >KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >KOG3467 consensus Histone H4 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >PLN00154 histone H2A; Provisional | Back alignment and domain information |
|---|
| >smart00414 H2A Histone 2A | Back alignment and domain information |
|---|
| >PTZ00017 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) | Back alignment and domain information |
|---|
| >PLN00156 histone H2AX; Provisional | Back alignment and domain information |
|---|
| >PLN00157 histone H2A; Provisional | Back alignment and domain information |
|---|
| >PLN00153 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] | Back alignment and domain information |
|---|
| >PTZ00252 histone H2A; Provisional | Back alignment and domain information |
|---|
| >COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >KOG1756 consensus Histone 2A [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] | Back alignment and domain information |
|---|
| >cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex | Back alignment and domain information |
|---|
| >KOG4336 consensus TBP-associated transcription factor Prodos [Transcription] | Back alignment and domain information |
|---|
| >PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site | Back alignment and domain information |
|---|
| >KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] | Back alignment and domain information |
|---|
| >PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex | Back alignment and domain information |
|---|
| >PF09123 DUF1931: Domain of unknown function (DUF1931); InterPro: IPR015207 This entry represents a set of hypothetical bacterial proteins containing a core of six alpha-helices, where one central helix is surrounded by the other five | Back alignment and domain information |
|---|
| >COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 136 | ||||
| 2hio_C | 136 | Histone Octamer (Chicken), Chromosomal Protein Leng | 2e-72 | ||
| 3av1_A | 139 | The Human Nucleosome Structure Containing The Histo | 3e-72 | ||
| 2cv5_A | 136 | Crystal Structure Of Human Nucleosome Core Particle | 4e-72 | ||
| 3afa_A | 139 | The Human Nucleosome Structure Length = 139 | 5e-72 | ||
| 3lel_A | 136 | Structural Insight Into The Sequence-Dependence Of | 1e-71 | ||
| 3azh_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 1e-71 | ||
| 3azg_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 1e-71 | ||
| 3azf_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 1e-71 | ||
| 3aze_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 1e-71 | ||
| 3ayw_A | 139 | Crystal Structure Of Human Nucleosome Core Particle | 1e-71 | ||
| 2io5_B | 135 | Crystal Structure Of The Cia- Histone H3-H4 Complex | 2e-71 | ||
| 4hga_B | 136 | Structure Of The Variant Histone H3.3-H4 Heterodime | 2e-71 | ||
| 3av2_A | 139 | The Human Nucleosome Structure Containing The Histo | 2e-71 | ||
| 1kx3_A | 135 | X-Ray Structure Of The Nucleosome Core Particle, Nc | 6e-71 | ||
| 1f66_A | 136 | 2.6 A Crystal Structure Of A Nucleosome Core Partic | 9e-71 | ||
| 3kxb_A | 135 | Structural Characterization Of H3k56q Nucleosomes A | 2e-70 | ||
| 3a6n_A | 139 | The Nucleosome Containing A Testis-Specific Histone | 2e-70 | ||
| 1zla_A | 135 | X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L | 5e-70 | ||
| 1m18_A | 135 | Ligand Binding Alters The Structure And Dynamics Of | 2e-69 | ||
| 1p3b_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-69 | ||
| 4h9o_A | 135 | Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length | 2e-69 | ||
| 3c1c_A | 135 | The Effect Of H3 K79 Dimethylation And H4 K20 Trime | 3e-69 | ||
| 1p3k_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 7e-69 | ||
| 1p3m_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 9e-69 | ||
| 1p3a_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-68 | ||
| 1p34_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 1e-68 | ||
| 1p3l_A | 135 | Crystallographic Studies Of Nucleosome Core Particl | 2e-68 | ||
| 4h9n_A | 135 | Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 | 2e-68 | ||
| 4h9s_A | 135 | Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 | 2e-67 | ||
| 1id3_A | 135 | Crystal Structure Of The Yeast Nucleosome Core Part | 4e-64 | ||
| 4h9p_A | 135 | Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length | 9e-63 | ||
| 1aoi_A | 116 | Complex Between Nucleosome Core Particle (H3,H4,H2a | 4e-60 | ||
| 3kwq_A | 98 | Structural Characterization Of H3k56q Nucleosomes A | 4e-50 | ||
| 1hio_C | 93 | Histone Octamer (Chicken), Chromosomal Protein, Alp | 3e-47 | ||
| 2hue_B | 77 | Structure Of The H3-h4 Chaperone Asf1 Bound To Hist | 9e-37 | ||
| 4eo5_B | 76 | Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | 1e-36 | ||
| 2yfv_A | 100 | The Heterotrimeric Complex Of Kluyveromyces Lactis | 8e-31 | ||
| 2yfw_A | 92 | Heterotetramer Structure Of Kluyveromyces Lactis Cs | 3e-29 | ||
| 3nqu_A | 140 | Crystal Structure Of Partially Trypsinized (Cenp-AH | 7e-27 | ||
| 3r45_A | 156 | Structure Of A Cenp-A-Histone H4 Heterodimer In Com | 8e-27 | ||
| 3an2_A | 143 | The Structure Of The Centromeric Nucleosome Contain | 8e-27 | ||
| 2l5a_A | 235 | Structural Basis For Recognition Of Centromere Spec | 2e-25 | ||
| 3nqj_A | 82 | Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len | 5e-21 | ||
| 2ly8_A | 121 | The Budding Yeast Chaperone Scm3 Recognizes The Par | 1e-14 | ||
| 4ft4_P | 32 | Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 | 5e-09 | ||
| 4hsu_C | 30 | Crystal Structure Of Lsd2-npac With H3(1-26)in Spac | 2e-08 | ||
| 3n9p_B | 32 | Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 | 4e-08 | ||
| 3n9n_B | 32 | Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P | 4e-08 | ||
| 4gu0_E | 26 | Crystal Structure Of Lsd2 With H3 Length = 26 | 3e-06 | ||
| 3u5p_I | 28 | Crystal Structure Of The Complex Of Trim33 Phd-Brom | 9e-06 | ||
| 2p5b_I | 22 | The Complex Structure Of Jmjd2a And Trimethylated H | 5e-05 | ||
| 3a1b_A | 159 | Crystal Structure Of The Dnmt3a Add Domain In Compl | 6e-05 | ||
| 3kv4_B | 24 | Structure Of Phf8 In Complex With Histone H3 Length | 6e-05 | ||
| 2x4w_B | 21 | Molecular Basis Of Histone H3k36me3 Recognition By | 2e-04 | ||
| 2kft_B | 21 | Nmr Solution Structure Of The First Phd Finger Doma | 3e-04 | ||
| 3avr_B | 22 | Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H | 3e-04 | ||
| 2kwk_B | 20 | Solution Structures Of The Double Phd Fingers Of Hu | 3e-04 | ||
| 2uxn_E | 21 | Structural Basis Of Histone Demethylation By Lsd1 R | 4e-04 | ||
| 2v1d_C | 21 | Structural Basis Of Lsd1-Corest Selectivity In Hist | 5e-04 |
| >pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 | Back alignment and structure |
|
| >pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 | Back alignment and structure |
| >pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 | Back alignment and structure |
| >pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 | Back alignment and structure |
| >pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 | Back alignment and structure |
| >pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 | Back alignment and structure |
| >pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 | Back alignment and structure |
| >pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 | Back alignment and structure |
| >pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 | Back alignment and structure |
| >pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 | Back alignment and structure |
| >pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 | Back alignment and structure |
| >pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 | Back alignment and structure |
| >pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 | Back alignment and structure |
| >pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 | Back alignment and structure |
| >pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 | Back alignment and structure |
| >pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 | Back alignment and structure |
| >pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 | Back alignment and structure |
| >pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 | Back alignment and structure |
| >pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 | Back alignment and structure |
| >pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 | Back alignment and structure |
| >pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 | Back alignment and structure |
| >pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 | Back alignment and structure |
| >pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 | Back alignment and structure |
| >pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 | Back alignment and structure |
| >pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 | Back alignment and structure |
| >pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 | Back alignment and structure |
| >pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 | Back alignment and structure |
| >pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 | Back alignment and structure |
| >pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 | Back alignment and structure |
| >pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 | Back alignment and structure |
| >pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 | Back alignment and structure |
| >pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 | Back alignment and structure |
| >pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 | Back alignment and structure |
| >pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 | Back alignment and structure |
| >pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 | Back alignment and structure |
| >pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 | Back alignment and structure |
| >pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 | Back alignment and structure |
| >pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 | Back alignment and structure |
| >pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 | Back alignment and structure |
| >pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 | Back alignment and structure |
| >pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 | Back alignment and structure |
| >pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 | Back alignment and structure |
| >pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 | Back alignment and structure |
| >pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 | Back alignment and structure |
| >pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 | Back alignment and structure |
| >pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 | Back alignment and structure |
| >pdb|2KFT|B Chain B, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 21 | Back alignment and structure |
| >pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 | Back alignment and structure |
| >pdb|2KWK|B Chain B, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3b Bound To A H3 Peptide Wild Type Length = 20 | Back alignment and structure |
| >pdb|2UXN|E Chain E, Structural Basis Of Histone Demethylation By Lsd1 Revealed By Suicide Inactivation Length = 21 | Back alignment and structure |
| >pdb|2V1D|C Chain C, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 21 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 136 | |||
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 4e-48 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 2e-39 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 6e-38 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 1e-36 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 1e-34 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 6e-33 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 2e-27 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 6e-05 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 1e-05 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 2e-04 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 5e-04 |
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 | Back alignment and structure |
|---|
Score = 150 bits (379), Expect = 4e-48
Identities = 131/136 (96%), Positives = 134/136 (98%)
Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQKSTE
Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60
Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
LLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120
Query: 121 MPKDIQLARRIRGERA 136
MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136
|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 | Back alignment and structure |
|---|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 | Back alignment and structure |
|---|
| >2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 | Back alignment and structure |
|---|
| >3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Length = 68 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| 1tzy_C | 136 | Histone H3; histone-fold, tetramer-dimer-dimer, DN | 100.0 | |
| 2yfv_A | 100 | Histone H3-like centromeric protein CSE4; cell cyc | 100.0 | |
| 3nqu_A | 140 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 3r45_A | 156 | Histone H3-like centromeric protein A; histone fol | 100.0 | |
| 2hue_B | 77 | Histone H3; mini beta sheet, elongated beta sandwh | 100.0 | |
| 3nqj_A | 82 | Histone H3-like centromeric protein A; alpha helix | 100.0 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 100.0 | |
| 2ly8_A | 121 | Budding yeast chaperone SCM3; centromere protein, | 99.93 | |
| 1b67_A | 68 | Protein (histone HMFA); DNA binding protein; 1.48A | 99.84 | |
| 1ku5_A | 70 | HPHA, archaeal histon; histone fold, DNA binding p | 99.76 | |
| 1n1j_A | 93 | NF-YB; histone-like PAIR, DNA binding protein; 1.6 | 99.65 | |
| 1id3_B | 102 | Histone H4; nucleosome core particle, chromatin, p | 99.32 | |
| 1tzy_D | 103 | Histone H4-VI; histone-fold, tetramer-dimer-dimer, | 99.32 | |
| 2yfw_B | 103 | Histone H4, H4; cell cycle, kinetochore, centromer | 99.32 | |
| 2hue_C | 84 | Histone H4; mini beta sheet, elongated beta sandwh | 99.29 | |
| 2nqb_D | 123 | Histone H2B; nucleosome, NCP, chromatin, structura | 99.28 | |
| 1tzy_B | 126 | Histone H2B; histone-fold, tetramer-dimer-dimer, D | 99.27 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.23 | |
| 3b0c_T | 111 | CENP-T, centromere protein T; histone fold, DNA bi | 99.22 | |
| 3b0c_W | 76 | CENP-W, centromere protein W; histone fold, DNA bi | 99.18 | |
| 1taf_B | 70 | TFIID TBP associated factor 62; transcription init | 99.13 | |
| 1f1e_A | 154 | Histone fold protein; archaeal histone protein, DN | 99.09 | |
| 1taf_A | 68 | TFIID TBP associated factor 42; transcription init | 99.05 | |
| 3v9r_A | 90 | MHF1, uncharacterized protein YOL086W-A; histone f | 98.92 | |
| 4dra_A | 113 | Centromere protein S; DNA binding complex, DNA dam | 98.89 | |
| 2byk_B | 128 | Chrac-14; nucleosome sliding, histone fold, DNA-bi | 98.89 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 98.87 | |
| 3b0b_B | 107 | CENP-S, centromere protein S; histone fold, DNA bi | 98.86 | |
| 3vh5_A | 140 | CENP-S; histone fold, chromosome segregation, DNA | 98.79 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 98.77 | |
| 1n1j_B | 97 | NF-YC; histone-like PAIR, DNA binding protein; 1.6 | 98.67 | |
| 4g92_C | 119 | HAPE; transcription factor, nucleosome, minor groo | 98.55 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 98.51 | |
| 2l5a_A | 235 | Histone H3-like centromeric protein CSE4, protein | 98.41 | |
| 2f8n_G | 120 | Core histone macro-H2A.1; nucleosome, NCP, macroh2 | 98.41 | |
| 2nqb_C | 123 | Histone H2A; nucleosome, NCP, chromatin, structura | 98.37 | |
| 1tzy_A | 129 | Histone H2A-IV; histone-fold, tetramer-dimer-dimer | 98.35 | |
| 2f8n_K | 149 | Histone H2A type 1; nucleosome, NCP, macroh2A, his | 98.29 | |
| 1h3o_B | 76 | Transcription initiation factor TFIID 20/15 kDa su | 98.27 | |
| 1jfi_A | 98 | Transcription regulator NC2 alpha chain; histone, | 98.26 | |
| 1f66_C | 128 | Histone H2A.Z; nucleosome, chromatin, histone vari | 98.26 | |
| 1id3_C | 131 | Histone H2A.1; nucleosome core particle, chromatin | 98.24 | |
| 2jss_A | 192 | Chimera of histone H2B.1 and histone H2A.Z; histon | 98.06 | |
| 2byk_A | 140 | Chrac-16; nucleosome sliding, histone fold, DNA-bi | 97.89 | |
| 2x4w_B | 26 | Histone H3.2; transcription, metal-binding, zinc-f | 97.18 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 92.67 | |
| 3avr_B | 26 | Histone H3; cupin superfamily, TRI/dimethyllysine | 92.41 | |
| 4dra_E | 84 | Centromere protein X; DNA binding complex, DNA dam | 92.21 | |
| 3b0b_C | 81 | CENP-X, centromere protein X; histone fold, DNA bi | 90.74 | |
| 1r4v_A | 171 | Hypothetical protein AQ_328; structural genomics, | 85.26 | |
| 1wwi_A | 148 | Hypothetical protein TTHA1479; structural genomics | 82.92 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 82.37 |
| >1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... | Back alignment and structure |
|---|
Probab=100.00 E-value=5.2e-61 Score=355.87 Aligned_cols=136 Identities=96% Similarity=1.332 Sum_probs=93.7
Q ss_pred CCcccccccccCCCCCCCcchhhhhcccCCCCCCCCCCCcccCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhh
Q 032681 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK 80 (136)
Q Consensus 1 Martk~~a~ks~g~kap~k~~~~k~~~~~~p~~~~~~k~~r~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~ 80 (136)
||||||+|++++||++|+|++++++++++.|..+++++++||+||+++|+|||+||+||+||||++||+|||+||++++.
T Consensus 1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~ 80 (136)
T 1tzy_C 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK 80 (136)
T ss_dssp -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccChhhHHHHHHHhcccC
Q 032681 81 TDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 (136)
Q Consensus 81 ~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~~kDiqla~rir~~~~ 136 (136)
+++|||++|+++|||++|+|||+||||+|+||+||||||||++|||||++|||+++
T Consensus 81 ~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kDiqLa~rirg~~~ 136 (136)
T 1tzy_C 81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136 (136)
T ss_dssp TTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHTCCC
T ss_pred hhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHhHHHHHHHhCcCC
Confidence 99999999999999999999999999999999999999999999999999999864
|
| >2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A | Back alignment and structure |
|---|
| >3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A | Back alignment and structure |
|---|
| >3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} | Back alignment and structure |
|---|
| >3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A | Back alignment and structure |
|---|
| >1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... | Back alignment and structure |
|---|
| >2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} | Back alignment and structure |
|---|
| >2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B | Back alignment and structure |
|---|
| >2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* | Back alignment and structure |
|---|
| >1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T | Back alignment and structure |
|---|
| >3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W | Back alignment and structure |
|---|
| >1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 | Back alignment and structure |
|---|
| >1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A | Back alignment and structure |
|---|
| >2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} | Back alignment and structure |
|---|
| >3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C | Back alignment and structure |
|---|
| >2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* | Back alignment and structure |
|---|
| >1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... | Back alignment and structure |
|---|
| >2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
| >1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 | Back alignment and structure |
|---|
| >2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 | Back alignment and structure |
|---|
| >2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J | Back alignment and structure |
|---|
| >3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D | Back alignment and structure |
|---|
| >1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 | Back alignment and structure |
|---|
| >1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 136 | ||||
| d1tzyc_ | 95 | a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), | 4e-56 | |
| d1f1ea_ | 151 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy | 6e-10 | |
| d1ku5a_ | 66 | a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc | 6e-05 | |
| d1q9ca_ | 172 | a.22.1.3 (A:) Histone domain of Son of sevenless p | 7e-05 | |
| d1htaa_ | 68 | a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth | 4e-04 | |
| d1n1ja_ | 87 | a.22.1.3 (A:) Nuclear transcription factor Y subun | 6e-04 | |
| d1tafa_ | 68 | a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila mel | 0.002 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Score = 168 bits (426), Expect = 4e-56
Identities = 91/95 (95%), Positives = 94/95 (98%)
Query: 42 YRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYL 101
YRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYL
Sbjct: 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60
Query: 102 VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 61 VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 95
|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 136 | |||
| d1tzyc_ | 95 | Histone H3 {Chicken (Gallus gallus), erythrocytes | 100.0 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 99.43 | |
| d1htaa_ | 68 | Archaeal histone {Archaeon Methanothermus fervidus | 99.4 | |
| d1ku5a_ | 66 | Archaeal histone {Archaeon (Pyrococcus horikoshii) | 99.31 | |
| d1tzyb_ | 92 | Histone H2B {Chicken (Gallus gallus), erythrocytes | 99.15 | |
| d2huec1 | 82 | Histone H4 {African clawed frog (Xenopus laevis) [ | 99.07 | |
| d1f1ea_ | 151 | Archaeal histone {Archaeon Methanopyrus kandleri [ | 98.99 | |
| d1n1ja_ | 87 | Nuclear transcription factor Y subunit beta (Nf-Yb | 98.96 | |
| d1jfib_ | 135 | Negative cofactor 2, NC2, beta chain {Human (Homo | 98.71 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 98.69 | |
| d1n1jb_ | 78 | Nuclear transcription factor Y subunit gamma (Nf-Y | 98.57 | |
| d2bykb1 | 89 | Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax | 98.55 | |
| d1jfia_ | 66 | Negative cofactor 2, NC2, alpha chain {Human (Homo | 98.49 | |
| d1tafa_ | 68 | TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta | 98.12 | |
| d1tafb_ | 70 | TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta | 98.05 | |
| d1h3ob_ | 74 | TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom | 98.04 | |
| d1u35c1 | 106 | macro-H2A.1, histone domain {Human (Homo sapiens) | 96.91 | |
| d2byka1 | 72 | Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax | 96.87 | |
| d1f66c_ | 103 | Histone H2A {Human (Homo sapiens), variant H2A.Z [ | 96.86 | |
| d1tzya_ | 106 | Histone H2A {Chicken (Gallus gallus), erythrocytes | 96.65 | |
| d1q9ca_ | 172 | Histone domain of Son of sevenless protein {Human | 96.34 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 86.07 | |
| d1wwia1 | 148 | Hypothetical protein TTHA1479 {Thermus thermophilu | 83.4 | |
| d1bh9b_ | 89 | TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | 81.89 | |
| d1r4va_ | 151 | Hypothetical protein Aq_328 {Aquifex aeolicus [Tax | 81.63 |
| >d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Histone-fold superfamily: Histone-fold family: Nucleosome core histones domain: Histone H3 species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00 E-value=9e-48 Score=268.24 Aligned_cols=95 Identities=96% Similarity=1.361 Sum_probs=93.6
Q ss_pred cCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccC
Q 032681 42 YRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM 121 (136)
Q Consensus 42 ~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~ 121 (136)
||||+++|+|||+||+||++||||+||+||||||++++.+++||+++|+++||||+|+|||++|||||+||+|+||||||
T Consensus 1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRvTl~ 80 (95)
T d1tzyc_ 1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM 80 (95)
T ss_dssp CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCcCC
Confidence 79999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhHHHHHHHhcccC
Q 032681 122 PKDIQLARRIRGERA 136 (136)
Q Consensus 122 ~kDiqla~rir~~~~ 136 (136)
++||+||++|||+++
T Consensus 81 ~kD~~LarrirG~r~ 95 (95)
T d1tzyc_ 81 PKDIQLARRIRGERA 95 (95)
T ss_dssp HHHHHHHHHHHTCCC
T ss_pred HHHHHHHHHHhccCC
Confidence 999999999999975
|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r4va_ a.22.1.4 (A:) Hypothetical protein Aq_328 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|