Citrus Sinensis ID: 032681


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
ccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHccccHHHHHccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccc
cccccHcHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEcHHHHHHHHHHccccc
martkqtarkstggkaprkQLATKAarksapttggvkkphryrpgtVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFedtnlcaihakrvtimpKDIQLARRIRGERA
martkqtarkstggkaprkqlatkaarksapttggvkkphryrpgtvalrEIRKYQKSTellirklpfqRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIhakrvtimpkdiqlarrirgera
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
********************************************GTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLA********
*ART**********************************PHRYRPGTVALREIRKY**STELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE**
**************************************PHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
**************************************PHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIR****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q71H73136 Histone H3.3 OS=Vitis vin yes no 1.0 1.0 1.0 1e-73
Q76N23136 Histone H3.3 OS=Nicotiana N/A no 1.0 1.0 1.0 1e-73
Q711T2136 Histone H3.3 OS=Pinus pin N/A no 1.0 1.0 1.0 1e-73
Q0JCT1136 Histone H3.3 OS=Oryza sat yes no 1.0 1.0 1.0 1e-73
A2XHJ3136 Histone H3.3 OS=Oryza sat N/A no 1.0 1.0 1.0 1e-73
Q71U98136 Histone H3.3 OS=Oryza coa N/A no 1.0 1.0 1.0 1e-73
P69244136 Histone H3.3 OS=Medicago N/A no 1.0 1.0 1.0 1e-73
P69245136 Histone H3.3 OS=Lolium te N/A no 1.0 1.0 1.0 1e-73
Q3C2E5136 Histone H3.3 OS=Lolium mu N/A no 1.0 1.0 1.0 1e-73
Q71V89136 Histone H3.3 OS=Gossypium N/A no 1.0 1.0 1.0 1e-73
>sp|Q71H73|H33_VITVI Histone H3.3 OS=Vitis vinifera PE=2 SV=3 Back     alignment and function desciption
 Score =  274 bits (700), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
           LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 121 MPKDIQLARRIRGERA 136
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136




Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Vitis vinifera (taxid: 29760)
>sp|Q76N23|H33_TOBAC Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1 Back     alignment and function description
>sp|Q711T2|H33_PINPS Histone H3.3 OS=Pinus pinaster PE=2 SV=3 Back     alignment and function description
>sp|Q0JCT1|H33_ORYSJ Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3 PE=2 SV=2 Back     alignment and function description
>sp|A2XHJ3|H33_ORYSI Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_011536 PE=2 SV=1 Back     alignment and function description
>sp|Q71U98|H33_ORYCO Histone H3.3 OS=Oryza coarctata PE=2 SV=3 Back     alignment and function description
>sp|P69244|H33_MEDSA Histone H3.3 OS=Medicago sativa PE=1 SV=2 Back     alignment and function description
>sp|P69245|H33_LOLTE Histone H3.3 OS=Lolium temulentum PE=2 SV=2 Back     alignment and function description
>sp|Q3C2E5|H33_LOLMU Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=3 Back     alignment and function description
>sp|Q71V89|H33_GOSHI Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
413953368227 histone H3 [Zea mays] 1.0 0.599 1.0 2e-72
413937382171 histone H3, partial [Zea mays] 1.0 0.795 1.0 5e-72
145334271164 histone H3 [Arabidopsis thaliana] gi|332 1.0 0.829 1.0 6e-72
357476499 391 Histone H3 [Medicago truncatula] gi|3555 1.0 0.347 1.0 8e-72
296083584147 unnamed protein product [Vitis vinifera] 1.0 0.925 1.0 8e-72
414867092165 TPA: histone H3 [Zea mays] 1.0 0.824 1.0 8e-72
147826736137 hypothetical protein VITISV_010022 [Viti 1.0 0.992 1.0 8e-72
15236103136 histone H3 [Arabidopsis thaliana] gi|152 1.0 1.0 1.0 1e-71
195606516161 histone H3 [Zea mays] 1.0 0.844 0.992 1e-71
195658747136 histone H3 [Zea mays] 1.0 1.0 0.992 2e-71
>gi|413953368|gb|AFW86017.1| histone H3 [Zea mays] Back     alignment and taxonomy information
 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
Sbjct: 92  MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 151

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
           LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 152 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 211

Query: 121 MPKDIQLARRIRGERA 136
           MPKDIQLARRIRGERA
Sbjct: 212 MPKDIQLARRIRGERA 227




Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|413937382|gb|AFW71933.1| histone H3, partial [Zea mays] Back     alignment and taxonomy information
>gi|145334271|ref|NP_001078516.1| histone H3 [Arabidopsis thaliana] gi|332661756|gb|AEE87156.1| histone H3 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357476499|ref|XP_003608535.1| Histone H3 [Medicago truncatula] gi|355509590|gb|AES90732.1| Histone H3 [Medicago truncatula] Back     alignment and taxonomy information
>gi|296083584|emb|CBI23573.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|414867092|tpg|DAA45649.1| TPA: histone H3 [Zea mays] Back     alignment and taxonomy information
>gi|147826736|emb|CAN70652.1| hypothetical protein VITISV_010022 [Vitis vinifera] Back     alignment and taxonomy information
>gi|15236103|ref|NP_195713.1| histone H3 [Arabidopsis thaliana] gi|15238916|ref|NP_196659.1| histone H3 [Arabidopsis thaliana] gi|30692585|ref|NP_849529.1| histone H3 [Arabidopsis thaliana] gi|79326608|ref|NP_001031816.1| histone H3 [Arabidopsis thaliana] gi|115453351|ref|NP_001050276.1| Os03g0390600 [Oryza sativa Japonica Group] gi|115466188|ref|NP_001056693.1| Os06g0130900 [Oryza sativa Japonica Group] gi|145334273|ref|NP_001078517.1| histone H3 [Arabidopsis thaliana] gi|212721898|ref|NP_001131417.1| uncharacterized protein LOC100192746 [Zea mays] gi|350535881|ref|NP_001234218.1| histone H3 variant H3.3 [Solanum lycopersicum] gi|351724645|ref|NP_001235785.1| uncharacterized protein LOC100305466 [Glycine max] gi|167998945|ref|XP_001752178.1| histone H3 [Physcomitrella patens subsp. patens] gi|167999057|ref|XP_001752234.1| histone H3 [Physcomitrella patens subsp. patens] gi|167999225|ref|XP_001752318.1| histone H3 [Physcomitrella patens subsp. patens] gi|224062043|ref|XP_002300726.1| histone H3 [Populus trichocarpa] gi|224066983|ref|XP_002302311.1| histone H3 [Populus trichocarpa] gi|224081102|ref|XP_002306294.1| histone H3 [Populus trichocarpa] gi|224085804|ref|XP_002307702.1| histone H3 [Populus trichocarpa] gi|224093720|ref|XP_002309961.1| histone H3 [Populus trichocarpa] gi|224097140|ref|XP_002310848.1| histone H3 [Populus trichocarpa] gi|225431185|ref|XP_002270349.1| PREDICTED: histone H3.3-like [Vitis vinifera] gi|225458071|ref|XP_002278857.1| PREDICTED: histone H3.3-like isoform 3 [Vitis vinifera] gi|225458073|ref|XP_002278809.1| PREDICTED: histone H3.3-like isoform 1 [Vitis vinifera] gi|225458075|ref|XP_002278833.1| PREDICTED: histone H3.3-like isoform 2 [Vitis vinifera] gi|242040731|ref|XP_002467760.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor] gi|242094532|ref|XP_002437756.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor] gi|255538848|ref|XP_002510489.1| histone h3, putative [Ricinus communis] gi|255538850|ref|XP_002510490.1| histone h3, putative [Ricinus communis] gi|255545798|ref|XP_002513959.1| histone h3, putative [Ricinus communis] gi|255581420|ref|XP_002531518.1| histone h3, putative [Ricinus communis] gi|297811211|ref|XP_002873489.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] gi|302792052|ref|XP_002977792.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] gi|302810438|ref|XP_002986910.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] gi|356540261|ref|XP_003538608.1| PREDICTED: histone H3.3-like isoform 1 [Glycine max] gi|356540263|ref|XP_003538609.1| PREDICTED: histone H3.3-like isoform 2 [Glycine max] gi|356540265|ref|XP_003538610.1| PREDICTED: histone H3.3-like isoform 3 [Glycine max] gi|356540267|ref|XP_003538611.1| PREDICTED: histone H3.3-like [Glycine max] gi|356553405|ref|XP_003545047.1| PREDICTED: histone H3.3-like [Glycine max] gi|356564335|ref|XP_003550410.1| PREDICTED: histone H3.3-like [Glycine max] gi|356567640|ref|XP_003552025.1| PREDICTED: histone H3.3-like [Glycine max] gi|357110653|ref|XP_003557131.1| PREDICTED: histone H3.3-like [Brachypodium distachyon] gi|357110657|ref|XP_003557133.1| PREDICTED: histone H3.3-like [Brachypodium distachyon] gi|357163855|ref|XP_003579868.1| PREDICTED: histone H3.3-like isoform 1 [Brachypodium distachyon] gi|357163858|ref|XP_003579869.1| PREDICTED: histone H3.3-like isoform 2 [Brachypodium distachyon] gi|357438217|ref|XP_003589384.1| Histone H3 [Medicago truncatula] gi|357516543|ref|XP_003628560.1| Histone H3 [Medicago truncatula] gi|359480475|ref|XP_003632470.1| PREDICTED: histone H3.3 isoform 1 [Vitis vinifera] gi|359480477|ref|XP_003632471.1| PREDICTED: histone H3.3 isoform 2 [Vitis vinifera] gi|359480479|ref|XP_003632472.1| PREDICTED: histone H3.3 isoform 3 [Vitis vinifera] gi|359480481|ref|XP_003632473.1| PREDICTED: histone H3.3 isoform 4 [Vitis vinifera] gi|359480483|ref|XP_003632474.1| PREDICTED: histone H3.3 isoform 5 [Vitis vinifera] gi|359497883|ref|XP_003635681.1| PREDICTED: histone H3.3-like [Vitis vinifera] gi|449458279|ref|XP_004146875.1| PREDICTED: histone H3.3-like [Cucumis sativus] gi|449469837|ref|XP_004152625.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus] gi|449469839|ref|XP_004152626.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus] gi|449503915|ref|XP_004162225.1| PREDICTED: histone H3.3-like isoform 1 [Cucumis sativus] gi|449503917|ref|XP_004162226.1| PREDICTED: histone H3.3-like isoform 2 [Cucumis sativus] gi|449522454|ref|XP_004168241.1| PREDICTED: histone H3.3-like [Cucumis sativus] gi|27734400|sp|P59169.2|H33_ARATH RecName: Full=Histone H3.3; AltName: Full=Histone H3.2 gi|54035960|sp|Q71V89.3|H33_GOSHI RecName: Full=Histone H3.3 gi|59799551|sp|P69245.2|H33_LOLTE RecName: Full=Histone H3.3 gi|59799580|sp|P69244.2|H33_MEDSA RecName: Full=Histone H3.3; AltName: Full=Histone H3.2; AltName: Full=Minor histone H3 gi|73919839|sp|Q71H73.3|H33_VITVI RecName: Full=Histone H3.3 gi|73919913|sp|Q6RUR1.3|H33_CAPAN RecName: Full=Histone H3.3 gi|73919918|sp|Q71U98.3|H33_ORYCO RecName: Full=Histone H3.3 gi|73919919|sp|Q711T2.3|H33_PINPS RecName: Full=Histone H3.3 gi|75138729|sp|Q76N23.1|H33_TOBAC RecName: Full=Histone H3.3 gi|119370648|sp|Q3C2E5.3|H33_LOLMU RecName: Full=Histone H3.3; AltName: Full=Replacement histone H3 gi|158512877|sp|A2XHJ3.1|H33_ORYSI RecName: Full=Histone H3.3; AltName: Full=H3.2 gi|158564092|sp|Q0JCT1.2|H33_ORYSJ RecName: Full=Histone H3.3; AltName: Full=H3.2 gi|14326562|gb|AAK60325.1|AF385735_1 AT4g40030/T5J17_200 [Arabidopsis thaliana] gi|16324|emb|CAA42957.1| histone H3.3 like protein [Arabidopsis thaliana] gi|404825|emb|CAA42958.1| histone H3.3 like protein [Arabidopsis thaliana] gi|488563|gb|AAB49538.1| histone H3.2 [Medicago sativa] gi|488567|gb|AAB36493.1| histone H3.2 [Medicago sativa] gi|488569|gb|AAB36494.1| histone H3.2 [Medicago sativa] gi|488575|gb|AAB36497.1| histone H3.2 [Medicago sativa] gi|488577|gb|AAB36498.1| histone H3.2 [Medicago sativa] gi|510911|emb|CAA56153.1| histone H3 [Lolium temulentum] gi|1435157|emb|CAA58445.1| histone H3 variant H3.3 [Solanum lycopersicum] gi|2558944|gb|AAB97162.1| histone 3 [Gossypium hirsutum] gi|3273350|dbj|BAA31218.1| histone H3 [Nicotiana tabacum] gi|3885890|gb|AAC78105.1| histone H3 [Oryza sativa Japonica Group] gi|4038469|gb|AAC97380.1| histone H3 [Oryza coarctata] gi|4490754|emb|CAB38916.1| histone H3.3 [Arabidopsis thaliana] gi|4490755|emb|CAB38917.1| Histon H3 [Arabidopsis thaliana] gi|6006364|dbj|BAA84794.1| histone H3 [Oryza sativa Japonica Group] gi|7271058|emb|CAB80666.1| histone H3.3 [Arabidopsis thaliana] gi|7271059|emb|CAB80667.1| Histon H3 [Arabidopsis thaliana] gi|8979732|emb|CAB96853.1| histon H3 protein [Arabidopsis thaliana] gi|17979505|gb|AAL50088.1| AT5g10980/T30N20_250 [Arabidopsis thaliana] gi|18700236|gb|AAL77728.1| AT4g40030/T5J17_200 [Arabidopsis thaliana] gi|20453305|gb|AAM19891.1| AT5g10980/T30N20_250 [Arabidopsis thaliana] gi|21554902|gb|AAM63725.1| histon H3 protein [Arabidopsis thaliana] gi|27311571|gb|AAO00751.1| Histon H3 [Arabidopsis thaliana] gi|28058719|gb|AAO29945.1| Histone H3 [Arabidopsis thaliana] gi|30024114|emb|CAC84678.1| putative histone H3 [Pinus pinaster] gi|30315015|gb|AAP30739.1| histone H3.3 [Vitis vinifera] gi|37991915|gb|AAR06361.1| histone H3.2 protein [Oryza sativa Japonica Group] gi|40353325|gb|AAR84425.1| histone H3-like protein [Capsicum annuum] gi|42541263|gb|AAS19511.1| putative histone H3 [Oryza sativa Japonica Group] gi|62642117|gb|AAX92697.1| histone 3 [Picea abies] gi|72398499|gb|AAZ72655.1| histone H3.1 [Craterostigma plantagineum] gi|72398501|gb|AAZ72656.1| histone H3.2 [Craterostigma plantagineum] gi|78210733|dbj|BAE47073.1| replacement histone H3 [Lolium multiflorum] gi|98960867|gb|ABF58917.1| At4g40040 [Arabidopsis thaliana] gi|106879571|emb|CAJ38369.1| histin H3 [Plantago major] gi|108708563|gb|ABF96358.1| Histone H3, putative, expressed [Oryza sativa Japonica Group] gi|108708564|gb|ABF96359.1| Histone H3, putative, expressed [Oryza sativa Japonica Group] gi|113548747|dbj|BAF12190.1| Os03g0390600 [Oryza sativa Japonica Group] gi|113594733|dbj|BAF18607.1| Os06g0130900 [Oryza sativa Japonica Group] gi|115394199|gb|ABI97039.1| histone H3 [Robinia pseudoacacia] gi|116310084|emb|CAH67105.1| H0818E04.22 [Oryza sativa Indica Group] gi|116310167|emb|CAH67180.1| H0815C01.1 [Oryza sativa Indica Group] gi|116779721|gb|ABK21404.1| unknown [Picea sitchensis] gi|116780910|gb|ABK21875.1| unknown [Picea sitchensis] gi|116783574|gb|ABK23002.1| unknown [Picea sitchensis] gi|116785270|gb|ABK23658.1| unknown [Picea sitchensis] gi|118485336|gb|ABK94527.1| unknown [Populus trichocarpa] gi|118485551|gb|ABK94627.1| unknown [Populus trichocarpa] gi|118485975|gb|ABK94832.1| unknown [Populus trichocarpa] gi|118489220|gb|ABK96416.1| unknown [Populus trichocarpa x Populus deltoides] gi|125544164|gb|EAY90303.1| hypothetical protein OsI_11878 [Oryza sativa Indica Group] gi|125590565|gb|EAZ30915.1| hypothetical protein OsJ_14996 [Oryza sativa Japonica Group] gi|125595930|gb|EAZ35710.1| hypothetical protein OsJ_19999 [Oryza sativa Japonica Group] gi|144953503|gb|ABP04114.1| histone 3 [Lemna minor] gi|147802094|emb|CAN70615.1| hypothetical protein VITISV_004842 [Vitis vinifera] gi|147856024|emb|CAN80736.1| hypothetical protein VITISV_034858 [Vitis vinifera] gi|147866150|emb|CAN81972.1| hypothetical protein VITISV_011984 [Vitis vinifera] gi|148905756|gb|ABR16042.1| unknown [Picea sitchensis] gi|148906054|gb|ABR16186.1| unknown [Picea sitchensis] gi|148907045|gb|ABR16666.1| unknown [Picea sitchensis] gi|148907691|gb|ABR16974.1| unknown [Picea sitchensis] gi|148907720|gb|ABR16987.1| unknown [Picea sitchensis] gi|148907797|gb|ABR17024.1| unknown [Picea sitchensis] gi|148910628|gb|ABR18384.1| unknown [Picea sitchensis] gi|151413347|gb|ABS11142.1| histone H3 [Solanum lycopersicum] gi|154550671|gb|ABS83501.1| U box domain-containing protein [Oryza sativa Japonica Group] gi|162696573|gb|EDQ82911.1| histone H3 [Physcomitrella patens subsp. patens] gi|162696629|gb|EDQ82967.1| histone H3 [Physcomitrella patens subsp. patens] gi|162696713|gb|EDQ83051.1| histone H3 [Physcomitrella patens subsp. patens] gi|169244475|gb|ACA50511.1| histone H3 [Oryza sativa Japonica Group] gi|192910840|gb|ACF06528.1| histone H3 [Elaeis guineensis] gi|192910874|gb|ACF06545.1| histone H3 [Elaeis guineensis] gi|194691462|gb|ACF79815.1| unknown [Zea mays] gi|194706414|gb|ACF87291.1| unknown [Zea mays] gi|194708778|gb|ACF88473.1| unknown [Zea mays] gi|195605410|gb|ACG24535.1| histone H3 [Zea mays] gi|195606204|gb|ACG24932.1| histone H3 [Zea mays] gi|195606344|gb|ACG25002.1| histone H3 [Zea mays] gi|195607550|gb|ACG25605.1| histone H3 [Zea mays] gi|195618422|gb|ACG31041.1| histone H3 [Zea mays] gi|195618436|gb|ACG31048.1| histone H3 [Zea mays] gi|195653337|gb|ACG46136.1| histone H3 [Zea mays] gi|215693207|dbj|BAG88589.1| unnamed protein product [Oryza sativa Japonica Group] gi|215740862|dbj|BAG97018.1| unnamed protein product [Oryza sativa Japonica Group] gi|218194947|gb|EEC77374.1| hypothetical protein OsI_16104 [Oryza sativa Indica Group] gi|222423947|dbj|BAH19936.1| AT4G40040 [Arabidopsis thaliana] gi|222424399|dbj|BAH20155.1| AT4G40040 [Arabidopsis thaliana] gi|222625050|gb|EEE59182.1| hypothetical protein OsJ_11116 [Oryza sativa Japonica Group] gi|222842452|gb|EEE79999.1| histone H3 [Populus trichocarpa] gi|222844037|gb|EEE81584.1| histone H3 [Populus trichocarpa] gi|222852864|gb|EEE90411.1| histone H3 [Populus trichocarpa] gi|222853751|gb|EEE91298.1| histone H3 [Populus trichocarpa] gi|222855743|gb|EEE93290.1| histone H3 [Populus trichocarpa] gi|222857151|gb|EEE94698.1| histone H3 [Populus trichocarpa] gi|223528871|gb|EEF30872.1| histone h3, putative [Ricinus communis] gi|223547045|gb|EEF48542.1| histone h3, putative [Ricinus communis] gi|223551190|gb|EEF52676.1| histone h3, putative [Ricinus communis] gi|223551191|gb|EEF52677.1| histone h3, putative [Ricinus communis] gi|224284828|gb|ACN40144.1| unknown [Picea sitchensis] gi|224286639|gb|ACN41024.1| unknown [Picea sitchensis] gi|224814382|gb|ACN65412.1| histone 3.2 [Pteris vittata] gi|238013324|gb|ACR37697.1| unknown [Zea mays] gi|241915979|gb|EER89123.1| hypothetical protein SORBIDRAFT_10g002040 [Sorghum bicolor] gi|241921614|gb|EER94758.1| hypothetical protein SORBIDRAFT_01g033550 [Sorghum bicolor] gi|255625589|gb|ACU13139.1| unknown [Glycine max] gi|294464776|gb|ADE77894.1| unknown [Picea sitchensis] gi|295002522|gb|ADF59039.1| histone H3.2 [Jatropha curcas] gi|297319326|gb|EFH49748.1| histone H3.2 [Arabidopsis lyrata subsp. lyrata] gi|297735036|emb|CBI17398.3| unnamed protein product [Vitis vinifera] gi|297741830|emb|CBI33143.3| unnamed protein product [Vitis vinifera] gi|298569751|gb|ADI87404.1| histone H3 [Oryza sativa] gi|298569753|gb|ADI87405.1| histone H3 [Oryza sativa] gi|298569757|gb|ADI87407.1| histone H3 [Oryza sativa] gi|300145315|gb|EFJ11992.1| hypothetical protein SELMODRAFT_182771 [Selaginella moellendorffii] gi|300154495|gb|EFJ21130.1| hypothetical protein SELMODRAFT_176603 [Selaginella moellendorffii] gi|302142605|emb|CBI19808.3| unnamed protein product [Vitis vinifera] gi|312985289|gb|ADR30795.1| histone H3.2 [Hevea brasiliensis] gi|319903990|gb|ADV77197.1| histone H3 [Cladophora coelothrix] gi|326503682|dbj|BAJ86347.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326504688|dbj|BAK06635.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326511152|dbj|BAJ87590.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|332004234|gb|AED91617.1| histone H3 [Arabidopsis thaliana] gi|332661755|gb|AEE87155.1| histone H3 [Arabidopsis thaliana] gi|332661757|gb|AEE87157.1| histone H3 [Arabidopsis thaliana] gi|332661758|gb|AEE87158.1| histone H3 [Arabidopsis thaliana] gi|332661759|gb|AEE87159.1| histone H3 [Arabidopsis thaliana] gi|354720970|dbj|BAL04972.1| histone H3 [Zoysia japonica] gi|355478432|gb|AES59635.1| Histone H3 [Medicago truncatula] gi|355522582|gb|AET03036.1| Histone H3 [Medicago truncatula] gi|374434006|gb|AEZ52395.1| histone H3 [Wolffia australiana] gi|379054876|gb|AFC88829.1| histone H23-like protein, partial [Miscanthus sinensis] gi|388490700|gb|AFK33416.1| unknown [Lotus japonicus] gi|388501438|gb|AFK38785.1| unknown [Medicago truncatula] gi|390633860|gb|AFM30053.1| histone H3 [Chimonanthus praecox] gi|399525606|gb|AFP44115.1| histone H3 [Lycoris longituba] gi|403081499|gb|AFR23066.1| hypothetical protein [Oryza sativa] gi|413937383|gb|AFW71934.1| histone H3 isoform 1 [Zea mays] gi|413937384|gb|AFW71935.1| histone H3 isoform 2 [Zea mays] gi|413937385|gb|AFW71936.1| histone H3 isoform 3 [Zea mays] gi|413942741|gb|AFW75390.1| histone H3 [Zea mays] gi|413953369|gb|AFW86018.1| histone H3 [Zea mays] gi|414867094|tpg|DAA45651.1| TPA: histone H3 isoform 1 [Zea mays] gi|414867095|tpg|DAA45652.1| TPA: histone H3 isoform 2 [Zea mays] Back     alignment and taxonomy information
>gi|195606516|gb|ACG25088.1| histone H3 [Zea mays] Back     alignment and taxonomy information
>gi|195658747|gb|ACG48841.1| histone H3 [Zea mays] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
TAIR|locus:2140010164 H3.3 "histone 3.3" [Arabidopsi 1.0 0.829 1.0 8.2e-67
TAIR|locus:2183795136 H3.3 "histone 3.3" [Arabidopsi 1.0 1.0 1.0 8.2e-67
TAIR|locus:2140025136 H3.3 "histone 3.3" [Arabidopsi 1.0 1.0 1.0 8.2e-67
FB|FBgn0051613136 His3:CG31613 "His3:CG31613" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053803136 His3:CG33803 "His3:CG33803" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053806136 His3:CG33806 "His3:CG33806" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053809136 His3:CG33809 "His3:CG33809" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053812136 His3:CG33812 "His3:CG33812" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053815136 His3:CG33815 "His3:CG33815" [D 1.0 1.0 0.963 1.8e-64
FB|FBgn0053818136 His3:CG33818 "His3:CG33818" [D 1.0 1.0 0.963 1.8e-64
TAIR|locus:2140010 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 679 (244.1 bits), Expect = 8.2e-67, P = 8.2e-67
 Identities = 136/136 (100%), Positives = 136/136 (100%)

Query:     1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
             MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
Sbjct:    29 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 88

Query:    61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
             LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct:    89 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 148

Query:   121 MPKDIQLARRIRGERA 136
             MPKDIQLARRIRGERA
Sbjct:   149 MPKDIQLARRIRGERA 164




GO:0000786 "nucleosome" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006334 "nucleosome assembly" evidence=IEA
TAIR|locus:2183795 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140025 H3.3 "histone 3.3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0051613 His3:CG31613 "His3:CG31613" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053803 His3:CG33803 "His3:CG33803" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053806 His3:CG33806 "His3:CG33806" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053809 His3:CG33809 "His3:CG33809" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053812 His3:CG33812 "His3:CG33812" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053815 His3:CG33815 "His3:CG33815" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0053818 His3:CG33818 "His3:CG33818" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84235H3_PLADUNo assigned EC number0.96321.01.0N/Ano
P84234H32_ONCMYNo assigned EC number0.96321.01.0N/Ano
Q402E2H33A_LILLONo assigned EC number0.97791.01.0N/Ano
Q76N23H33_TOBACNo assigned EC number1.01.01.0N/Ano
P84231H32_ICTBUNo assigned EC number0.96321.01.0N/Ano
Q71DI3H32_HUMANNo assigned EC number0.96321.01.0yesno
P84233H32_XENLANo assigned EC number0.96321.01.0N/Ano
P84232H32_PORAFNo assigned EC number0.96321.01.0N/Ano
Q6LCK1H32_BRANANo assigned EC number0.97051.01.0N/Ano
Q6RUR1H33_CAPANNo assigned EC number1.01.01.0N/Ano
P84239H3_URECANo assigned EC number0.96321.01.0N/Ano
P84237H3_TIGCANo assigned EC number0.96321.01.0N/Ano
P59169H33_ARATHNo assigned EC number1.01.01.0nono
P84236H3_DROHYNo assigned EC number0.96321.01.0N/Ano
Q6LED0H31_RATNo assigned EC number0.96321.01.0nono
P84230H32_CAIMONo assigned EC number0.96321.01.0N/Ano
Q71T45H32_EUPESNo assigned EC number0.97051.01.0N/Ano
Q711T2H33_PINPSNo assigned EC number1.01.01.0N/Ano
Q71V89H33_GOSHINo assigned EC number1.01.01.0N/Ano
Q3C2E5H33_LOLMUNo assigned EC number1.01.01.0N/Ano
P69245H33_LOLTENo assigned EC number1.01.01.0N/Ano
P69244H33_MEDSANo assigned EC number1.01.01.0N/Ano
P59226H32_ARATHNo assigned EC number0.97051.01.0nono
P69246H32_MAIZENo assigned EC number0.97051.01.0N/Ano
P69248H32_PETCRNo assigned EC number0.97051.01.0N/Ano
P68428H32_WHEATNo assigned EC number0.97051.01.0N/Ano
P68429H32_MEDSANo assigned EC number0.97051.01.0N/Ano
Q28D37H32_XENTRNo assigned EC number0.96321.01.0nono
P02299H3_DROMENo assigned EC number0.96321.01.0yesno
P84227H32_BOVINNo assigned EC number0.96321.01.0yesno
Q64400H32_CRILONo assigned EC number0.95581.01.0N/Ano
P68427H32_PEANo assigned EC number0.97051.01.0N/Ano
Q2RAD9H32_ORYSJNo assigned EC number0.97051.01.0yesno
Q76MV0H32_TOBACNo assigned EC number0.97051.01.0N/Ano
P84228H32_MOUSENo assigned EC number0.96321.01.0yesno
P84238H3_CHITHNo assigned EC number0.96321.01.0N/Ano
Q6LBE8H32_MUSPANo assigned EC number0.96321.01.0N/Ano
A2Y533H32_ORYSINo assigned EC number0.97051.01.0N/Ano
Q6LBE3H32_ASPOFNo assigned EC number0.97051.01.0N/Ano
P84229H32_CHICKNo assigned EC number0.96321.01.0yesno
Q4QRF4H32_DANRENo assigned EC number0.96321.01.0yesno
Q71U98H33_ORYCONo assigned EC number1.01.01.0N/Ano
Q6LBF0H31_MUSPANo assigned EC number0.96321.01.0N/Ano
A2XHJ3H33_ORYSINo assigned EC number1.01.01.0N/Ano
Q0JCT1H33_ORYSJNo assigned EC number1.01.01.0yesno
Q71H73H33_VITVINo assigned EC number1.01.01.0yesno
P68431H31_HUMANNo assigned EC number0.96321.01.0yesno
P68430H32_ONOVINo assigned EC number0.97051.01.0N/Ano
P68433H31_MOUSENo assigned EC number0.96321.01.0yesno
P68432H31_BOVINNo assigned EC number0.96321.01.0yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
PTZ00018136 PTZ00018, PTZ00018, histone H3; Provisional 5e-84
PLN00121136 PLN00121, PLN00121, histone H3; Provisional 5e-76
smart00428105 smart00428, H3, Histone H3 4e-57
PLN00161135 PLN00161, PLN00161, histone H3; Provisional 4e-44
PLN0016097 PLN00160, PLN00160, histone H3; Provisional 1e-36
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 1e-30
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 8e-28
>gnl|CDD|185400 PTZ00018, PTZ00018, histone H3; Provisional Back     alignment and domain information
 Score =  241 bits (617), Expect = 5e-84
 Identities = 130/136 (95%), Positives = 134/136 (98%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
           MARTKQTARKSTGGKAPRKQLA+KAARKSAP TGG+KKPHRYRPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
           LLIRKLPFQRLVREIAQDFKTDLRFQS AVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 121 MPKDIQLARRIRGERA 136
           MPKDIQLARRIRGER+
Sbjct: 121 MPKDIQLARRIRGERS 136


Length = 136

>gnl|CDD|177733 PLN00121, PLN00121, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|128705 smart00428, H3, Histone H3 Back     alignment and domain information
>gnl|CDD|215082 PLN00161, PLN00161, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|165727 PLN00160, PLN00160, histone H3; Provisional Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
PTZ00018136 histone H3; Provisional 100.0
PLN00121136 histone H3; Provisional 100.0
PLN00161135 histone H3; Provisional 100.0
KOG1745137 consensus Histones H3 and H4 [Chromatin structure 100.0
smart00428105 H3 Histone H3. 100.0
PLN0016097 histone H3; Provisional 100.0
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.94
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 99.84
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 99.43
cd0007685 H4 Histone H4, one of the four histones, along wit 99.33
PLN00035103 histone H4; Provisional 99.3
PTZ00015102 histone H4; Provisional 99.28
smart0080365 TAF TATA box binding protein associated factor. TA 99.22
smart0041774 H4 Histone H4. 99.14
PTZ00463117 histone H2B; Provisional 99.01
PLN00158116 histone H2B; Provisional 99.0
smart0042789 H2B Histone H2B. 98.99
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 98.83
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 98.76
KOG1744127 consensus Histone H2B [Chromatin structure and dyn 98.61
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 98.39
smart0057677 BTP Bromodomain transcription factors and PHD doma 98.36
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 98.29
KOG0870172 consensus DNA polymerase epsilon, subunit D [Trans 98.28
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 98.24
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 98.17
PF0296966 TAF: TATA box binding protein associated factor (T 98.06
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 97.94
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 97.89
KOG1142258 consensus Transcription initiation factor TFIID, s 97.7
KOG0869168 consensus CCAAT-binding factor, subunit A (HAP3) [ 97.35
KOG3334148 consensus Transcription initiation factor TFIID, s 97.13
KOG3467103 consensus Histone H4 [Chromatin structure and dyna 96.96
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 96.83
KOG0871156 consensus Class 2 transcription repressor NC2, bet 96.39
PLN00154136 histone H2A; Provisional 95.67
smart00414106 H2A Histone 2A. 95.67
PTZ00017134 histone H2A; Provisional 95.41
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 94.84
KOG2549 576 consensus Transcription initiation factor TFIID, s 94.47
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 94.38
PLN00156139 histone H2AX; Provisional 94.25
PLN00157132 histone H2A; Provisional 94.23
PLN00153129 histone H2A; Provisional 93.85
COG5094145 TAF9 Transcription initiation factor TFIID, subuni 93.25
PTZ00252134 histone H2A; Provisional 93.05
COG5150148 Class 2 transcription repressor NC2, beta subunit 92.99
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 91.39
COG5208 286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 91.25
cd08045212 TAF4 TATA Binding Protein (TBP) Associated Factor 91.16
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 90.16
KOG4336 323 consensus TBP-associated transcription factor Prod 89.57
PF05236 264 TAF4: Transcription initiation factor TFIID compon 89.45
KOG1657236 consensus CCAAT-binding factor, subunit C (HAP5) [ 86.7
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 84.82
PF09123138 DUF1931: Domain of unknown function (DUF1931); Int 80.38
COG5248126 TAF19 Transcription initiation factor TFIID, subun 80.04
>PTZ00018 histone H3; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.6e-56  Score=329.89  Aligned_cols=135  Identities=96%  Similarity=1.337  Sum_probs=129.8

Q ss_pred             CCcccccccccCCCCCCCcchhhhhcccCCCCCCCCCCCcccCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhh
Q 032681            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
Q Consensus         1 Martk~~a~ks~g~kap~k~~~~k~~~~~~p~~~~~~k~~r~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~   80 (136)
                      |||||+++++++|+++|+++.++++..++.+..++.++++||+||+++|+|||+||+||+||||++||+|||+||++++.
T Consensus         1 MaRtk~~~~k~~~~~~prk~~~~~~~~~~~~~~~~~~~~~r~rpGt~aLrEIr~yQkst~lLI~k~pF~RLVREI~~~~~   80 (136)
T PTZ00018          1 MARTKQTARKSTGGKAPRKQLASKAARKSAPVTGGIKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_pred             CCCCCcCccCCCCCCCCcccccccccccCCCCCCCCCCCcccCCchhHHHHHHHHcccchhccccccHHHHHHHHHHHcC
Confidence            99999999999999999999988877777777778889999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccChhhHHHHHHHhccc
Q 032681           81 TDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  135 (136)
Q Consensus        81 ~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~~kDiqla~rir~~~  135 (136)
                      .++||+++||++||||+|+|||+||||+|+||+||||||||++||+|+.+|||++
T Consensus        81 ~~~rf~~~al~aLQeaaE~yLv~lfed~~lca~HakRVTl~~kD~~L~~rirg~~  135 (136)
T PTZ00018         81 TDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER  135 (136)
T ss_pred             CcceeeHHHHHHHHHHHHHHHHHHhhhhHHHHHhhcceecchhhHHHHHHhcccC
Confidence            9999999999999999999999999999999999999999999999999999986



>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>KOG1744 consensus Histone H2B [Chromatin structure and dynamics] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] Back     alignment and domain information
>KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG3467 consensus Histone H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>COG5094 TAF9 Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>cd08045 TAF4 TATA Binding Protein (TBP) Associated Factor 4 (TAF4) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG4336 consensus TBP-associated transcription factor Prodos [Transcription] Back     alignment and domain information
>PF05236 TAF4: Transcription initiation factor TFIID component TAF4 family; InterPro: IPR007900 Accurate transcription initiation at protein-coding genes by RNA polymerase II requires the assembly of a multiprotein complex around the mRNA start site Back     alignment and domain information
>KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>PF09123 DUF1931: Domain of unknown function (DUF1931); InterPro: IPR015207 This entry represents a set of hypothetical bacterial proteins containing a core of six alpha-helices, where one central helix is surrounded by the other five Back     alignment and domain information
>COG5248 TAF19 Transcription initiation factor TFIID, subunit TAF13 [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
2hio_C136 Histone Octamer (Chicken), Chromosomal Protein Leng 2e-72
3av1_A139 The Human Nucleosome Structure Containing The Histo 3e-72
2cv5_A136 Crystal Structure Of Human Nucleosome Core Particle 4e-72
3afa_A139 The Human Nucleosome Structure Length = 139 5e-72
3lel_A136 Structural Insight Into The Sequence-Dependence Of 1e-71
3azh_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-71
3azg_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-71
3azf_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-71
3aze_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-71
3ayw_A139 Crystal Structure Of Human Nucleosome Core Particle 1e-71
2io5_B135 Crystal Structure Of The Cia- Histone H3-H4 Complex 2e-71
4hga_B136 Structure Of The Variant Histone H3.3-H4 Heterodime 2e-71
3av2_A139 The Human Nucleosome Structure Containing The Histo 2e-71
1kx3_A135 X-Ray Structure Of The Nucleosome Core Particle, Nc 6e-71
1f66_A136 2.6 A Crystal Structure Of A Nucleosome Core Partic 9e-71
3kxb_A135 Structural Characterization Of H3k56q Nucleosomes A 2e-70
3a6n_A139 The Nucleosome Containing A Testis-Specific Histone 2e-70
1zla_A135 X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus L 5e-70
1m18_A135 Ligand Binding Alters The Structure And Dynamics Of 2e-69
1p3b_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-69
4h9o_A135 Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length 2e-69
3c1c_A135 The Effect Of H3 K79 Dimethylation And H4 K20 Trime 3e-69
1p3k_A135 Crystallographic Studies Of Nucleosome Core Particl 7e-69
1p3m_A135 Crystallographic Studies Of Nucleosome Core Particl 9e-69
1p3a_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-68
1p34_A135 Crystallographic Studies Of Nucleosome Core Particl 1e-68
1p3l_A135 Crystallographic Studies Of Nucleosome Core Particl 2e-68
4h9n_A135 Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 13 2e-68
4h9s_A135 Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 13 2e-67
1id3_A135 Crystal Structure Of The Yeast Nucleosome Core Part 4e-64
4h9p_A135 Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length 9e-63
1aoi_A116 Complex Between Nucleosome Core Particle (H3,H4,H2a 4e-60
3kwq_A98 Structural Characterization Of H3k56q Nucleosomes A 4e-50
1hio_C93 Histone Octamer (Chicken), Chromosomal Protein, Alp 3e-47
2hue_B77 Structure Of The H3-h4 Chaperone Asf1 Bound To Hist 9e-37
4eo5_B76 Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 1e-36
2yfv_A100 The Heterotrimeric Complex Of Kluyveromyces Lactis 8e-31
2yfw_A92 Heterotetramer Structure Of Kluyveromyces Lactis Cs 3e-29
3nqu_A140 Crystal Structure Of Partially Trypsinized (Cenp-AH 7e-27
3r45_A156 Structure Of A Cenp-A-Histone H4 Heterodimer In Com 8e-27
3an2_A143 The Structure Of The Centromeric Nucleosome Contain 8e-27
2l5a_A 235 Structural Basis For Recognition Of Centromere Spec 2e-25
3nqj_A82 Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Len 5e-21
2ly8_A121 The Budding Yeast Chaperone Scm3 Recognizes The Par 1e-14
4ft4_P32 Crystal Structure Of Zea Mays Zmet2 In Complex H3(1 5e-09
4hsu_C30 Crystal Structure Of Lsd2-npac With H3(1-26)in Spac 2e-08
3n9p_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 4e-08
3n9n_B32 Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 P 4e-08
4gu0_E26 Crystal Structure Of Lsd2 With H3 Length = 26 3e-06
3u5p_I28 Crystal Structure Of The Complex Of Trim33 Phd-Brom 9e-06
2p5b_I22 The Complex Structure Of Jmjd2a And Trimethylated H 5e-05
3a1b_A159 Crystal Structure Of The Dnmt3a Add Domain In Compl 6e-05
3kv4_B24 Structure Of Phf8 In Complex With Histone H3 Length 6e-05
2x4w_B21 Molecular Basis Of Histone H3k36me3 Recognition By 2e-04
2kft_B21 Nmr Solution Structure Of The First Phd Finger Doma 3e-04
3avr_B22 Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H 3e-04
2kwk_B20 Solution Structures Of The Double Phd Fingers Of Hu 3e-04
2uxn_E21 Structural Basis Of Histone Demethylation By Lsd1 R 4e-04
2v1d_C21 Structural Basis Of Lsd1-Corest Selectivity In Hist 5e-04
>pdb|2HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein Length = 136 Back     alignment and structure

Iteration: 1

Score = 266 bits (681), Expect = 2e-72, Method: Compositional matrix adjust. Identities = 131/136 (96%), Positives = 134/136 (98%) Query: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60 MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQKSTE Sbjct: 1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60 Query: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120 LLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI Sbjct: 61 LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120 Query: 121 MPKDIQLARRIRGERA 136 MPKDIQLARRIRGERA Sbjct: 121 MPKDIQLARRIRGERA 136
>pdb|3AV1|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.2 Length = 139 Back     alignment and structure
>pdb|2CV5|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Length = 136 Back     alignment and structure
>pdb|3AFA|A Chain A, The Human Nucleosome Structure Length = 139 Back     alignment and structure
>pdb|3LEL|A Chain A, Structural Insight Into The Sequence-Dependence Of Nucleosom Positioning Length = 136 Back     alignment and structure
>pdb|3AZH|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k122q Mutation Length = 139 Back     alignment and structure
>pdb|3AZG|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k115q Mutation Length = 139 Back     alignment and structure
>pdb|3AZF|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k79q Mutation Length = 139 Back     alignment and structure
>pdb|3AZE|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k64q Mutation Length = 139 Back     alignment and structure
>pdb|3AYW|A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H3k56q Mutation Length = 139 Back     alignment and structure
>pdb|2IO5|B Chain B, Crystal Structure Of The Cia- Histone H3-H4 Complex Length = 135 Back     alignment and structure
>pdb|4HGA|B Chain B, Structure Of The Variant Histone H3.3-H4 Heterodimer In Complex With Its Chaperone Daxx Length = 136 Back     alignment and structure
>pdb|3AV2|A Chain A, The Human Nucleosome Structure Containing The Histone Variant H3.3 Length = 139 Back     alignment and structure
>pdb|1KX3|A Chain A, X-Ray Structure Of The Nucleosome Core Particle, Ncp146, At 2.0 A Resolution Length = 135 Back     alignment and structure
>pdb|1F66|A Chain A, 2.6 A Crystal Structure Of A Nucleosome Core Particle Containing The Variant Histone H2a.Z Length = 136 Back     alignment and structure
>pdb|3KXB|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleosomal Arrays Length = 135 Back     alignment and structure
>pdb|3A6N|A Chain A, The Nucleosome Containing A Testis-Specific Histone Variant, Human H3t Length = 139 Back     alignment and structure
>pdb|1ZLA|A Chain A, X-Ray Structure Of A Kaposi's Sarcoma Herpesvirus Lana Peptide Bound To The Nucleosomal Core Length = 135 Back     alignment and structure
>pdb|1M18|A Chain A, Ligand Binding Alters The Structure And Dynamics Of Nucleosomal Dna Length = 135 Back     alignment and structure
>pdb|1P3B|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4H9O|A Chain A, Complex Structure 2 Of DaxxH3.3(SUB5,G90M)H4 Length = 135 Back     alignment and structure
>pdb|3C1C|A Chain A, The Effect Of H3 K79 Dimethylation And H4 K20 Trimethylation On Nucleosome And Chromatin Structure Length = 135 Back     alignment and structure
>pdb|1P3K|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3M|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3A|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P34|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|1P3L|A Chain A, Crystallographic Studies Of Nucleosome Core Particles Containing Histone 'sin' Mutants Length = 135 Back     alignment and structure
>pdb|4H9N|A Chain A, Complex Structure 1 Of DaxxH3.3(SUB5)H4 Length = 135 Back     alignment and structure
>pdb|4H9S|A Chain A, Complex Structure 6 Of DaxxH3.3(SUB7)H4 Length = 135 Back     alignment and structure
>pdb|1ID3|A Chain A, Crystal Structure Of The Yeast Nucleosome Core Particle Reveals Fundamental Differences In Inter-Nucleosome Interactions Length = 135 Back     alignment and structure
>pdb|4H9P|A Chain A, Complex Structure 3 Of DaxxH3.3(SUB5,G90A)H4 Length = 135 Back     alignment and structure
>pdb|1AOI|A Chain A, Complex Between Nucleosome Core Particle (H3,H4,H2a,H2b) And 146 Bp Long Dna Fragment Length = 116 Back     alignment and structure
>pdb|3KWQ|A Chain A, Structural Characterization Of H3k56q Nucleosomes And Nucleo Arrays Length = 98 Back     alignment and structure
>pdb|1HIO|C Chain C, Histone Octamer (Chicken), Chromosomal Protein, Alpha Carbons Only Length = 93 Back     alignment and structure
>pdb|2HUE|B Chain B, Structure Of The H3-h4 Chaperone Asf1 Bound To Histones H3 And H4 Length = 77 Back     alignment and structure
>pdb|4EO5|B Chain B, Yeast Asf1 Bound To H3H4G94P MUTANT Length = 76 Back     alignment and structure
>pdb|2YFV|A Chain A, The Heterotrimeric Complex Of Kluyveromyces Lactis Scm3, Cse4 And H4 Length = 100 Back     alignment and structure
>pdb|2YFW|A Chain A, Heterotetramer Structure Of Kluyveromyces Lactis Cse4,H4 Length = 92 Back     alignment and structure
>pdb|3NQU|A Chain A, Crystal Structure Of Partially Trypsinized (Cenp-AH4)2 HETEROTETRAMER Length = 140 Back     alignment and structure
>pdb|3R45|A Chain A, Structure Of A Cenp-A-Histone H4 Heterodimer In Complex With Chaperone Hjurp Length = 156 Back     alignment and structure
>pdb|3AN2|A Chain A, The Structure Of The Centromeric Nucleosome Containing Cenp-A Length = 143 Back     alignment and structure
>pdb|2L5A|A Chain A, Structural Basis For Recognition Of Centromere Specific Histone H3 Variant By Nonhistone Scm3 Length = 235 Back     alignment and structure
>pdb|3NQJ|A Chain A, Crystal Structure Of (Cenp-AH4)2 HETEROTETRAMER Length = 82 Back     alignment and structure
>pdb|2LY8|A Chain A, The Budding Yeast Chaperone Scm3 Recognizes The Partially Unfolded Dimer Of The Centromere-specific Cse4/h4 Histone Variant Length = 121 Back     alignment and structure
>pdb|4FT4|P Chain P, Crystal Structure Of Zea Mays Zmet2 In Complex H3(1-32)k9me2 Peptide And Sah Length = 32 Back     alignment and structure
>pdb|4HSU|C Chain C, Crystal Structure Of Lsd2-npac With H3(1-26)in Space Group P21 Length = 30 Back     alignment and structure
>pdb|3N9P|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k27me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|3N9N|B Chain B, Cekdm7a From C.Elegans, Complex With H3k4me3k9me2 Peptide And Nog Length = 32 Back     alignment and structure
>pdb|4GU0|E Chain E, Crystal Structure Of Lsd2 With H3 Length = 26 Back     alignment and structure
>pdb|3U5P|I Chain I, Crystal Structure Of The Complex Of Trim33 Phd-Bromo And H3(1-28) K9me3k14ack18ack23ac Histone Peptide Length = 28 Back     alignment and structure
>pdb|2P5B|I Chain I, The Complex Structure Of Jmjd2a And Trimethylated H3k36 Peptide Length = 22 Back     alignment and structure
>pdb|3A1B|A Chain A, Crystal Structure Of The Dnmt3a Add Domain In Complex With Histone H3 Length = 159 Back     alignment and structure
>pdb|3KV4|B Chain B, Structure Of Phf8 In Complex With Histone H3 Length = 24 Back     alignment and structure
>pdb|2X4W|B Chain B, Molecular Basis Of Histone H3k36me3 Recognition By The Pwwp Domain Of Brpf1. Length = 21 Back     alignment and structure
>pdb|2KFT|B Chain B, Nmr Solution Structure Of The First Phd Finger Domain Of Human Autoimmune Regulator (Aire) In Complex With Histone H3(1-20cys) Peptide Length = 21 Back     alignment and structure
>pdb|3AVR|B Chain B, Catalytic Fragment Of UtxKDM6A BOUND WITH HISTONE H3K27ME3 PEPTIDE, N-Oxyalylglycine, And Ni(Ii) Length = 22 Back     alignment and structure
>pdb|2KWK|B Chain B, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3b Bound To A H3 Peptide Wild Type Length = 20 Back     alignment and structure
>pdb|2UXN|E Chain E, Structural Basis Of Histone Demethylation By Lsd1 Revealed By Suicide Inactivation Length = 21 Back     alignment and structure
>pdb|2V1D|C Chain C, Structural Basis Of Lsd1-Corest Selectivity In Histone H3 Recognition Length = 21 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 4e-48
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 2e-39
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 6e-38
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 1e-36
3r45_A156 Histone H3-like centromeric protein A; histone fol 1e-34
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 6e-33
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 2e-27
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 6e-05
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 1e-05
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 2e-04
1taf_A68 TFIID TBP associated factor 42; transcription init 5e-04
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Length = 136 Back     alignment and structure
 Score =  150 bits (379), Expect = 4e-48
 Identities = 131/136 (96%), Positives = 134/136 (98%)

Query: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE 60
           MARTKQTARKSTGGKAPRKQLATKAARKSAP TGGVKKPHRYRPGTVALREIR+YQKSTE
Sbjct: 1   MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE 60

Query: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI 120
           LLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYLVGLFEDTNLCAIHAKRVTI
Sbjct: 61  LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI 120

Query: 121 MPKDIQLARRIRGERA 136
           MPKDIQLARRIRGERA
Sbjct: 121 MPKDIQLARRIRGERA 136


>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Length = 77 Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Length = 100 Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Length = 140 Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Length = 156 Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Length = 82 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Length = 235 Back     alignment and structure
>2x4w_B Histone H3.2; transcription, metal-binding, zinc-finger, chromatin regulator, transcription regulation; HET: M3L; 1.50A {Homo sapiens} PDB: 2x4x_B* 2x4y_B* Length = 26 Back     alignment and structure
>3avr_B Histone H3; cupin superfamily, TRI/dimethyllysine demethylase, oxidoredu structural protein complex; HET: M3L OGA EDO; 1.80A {Homo sapiens} Length = 26 Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 100.0
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 100.0
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 100.0
3r45_A156 Histone H3-like centromeric protein A; histone fol 100.0
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 100.0
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 100.0
2l5a_A 235 Histone H3-like centromeric protein CSE4, protein 100.0
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 99.93
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.84
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.76
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.65
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 99.32
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.32
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.32
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 99.29
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 99.28
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 99.27
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.23
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 99.22
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 99.18
1taf_B70 TFIID TBP associated factor 62; transcription init 99.13
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.09
1taf_A68 TFIID TBP associated factor 42; transcription init 99.05
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 98.92
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 98.89
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 98.89
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 98.87
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 98.86
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 98.79
2jss_A 192 Chimera of histone H2B.1 and histone H2A.Z; histon 98.77
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 98.67
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 98.55
2r10_A 361 Chromatin structure-remodeling complex protein RSC 98.51
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 98.41
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 98.41
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 98.37
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 98.35
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 98.29
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 98.27
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 98.26
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 98.26
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 98.24
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 98.06
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 97.89
2x4w_B26 Histone H3.2; transcription, metal-binding, zinc-f 97.18
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 92.67
3avr_B26 Histone H3; cupin superfamily, TRI/dimethyllysine 92.41
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 92.21
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 90.74
1r4v_A171 Hypothetical protein AQ_328; structural genomics, 85.26
1wwi_A148 Hypothetical protein TTHA1479; structural genomics 82.92
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 82.37
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
Probab=100.00  E-value=5.2e-61  Score=355.87  Aligned_cols=136  Identities=96%  Similarity=1.332  Sum_probs=93.7

Q ss_pred             CCcccccccccCCCCCCCcchhhhhcccCCCCCCCCCCCcccCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhh
Q 032681            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
Q Consensus         1 Martk~~a~ks~g~kap~k~~~~k~~~~~~p~~~~~~k~~r~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~   80 (136)
                      ||||||+|++++||++|+|++++++++++.|..+++++++||+||+++|+|||+||+||+||||++||+|||+||++++.
T Consensus         1 MARtk~tarkstggkaprk~l~~k~a~k~~p~~~~~kk~~r~rpgt~alrEIr~yQkst~lLIpk~PF~RLVREI~~~~~   80 (136)
T 1tzy_C            1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK   80 (136)
T ss_dssp             -----------------------------------------CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHC
T ss_pred             CCCCccccccCCCCCCCCccccccccccCCCCCCCCCCCCCCCCchhHHHHHHHhhcchhhhhccchHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccChhhHHHHHHHhcccC
Q 032681           81 TDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  136 (136)
Q Consensus        81 ~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~~kDiqla~rir~~~~  136 (136)
                      +++|||++|+++|||++|+|||+||||+|+||+||||||||++|||||++|||+++
T Consensus        81 ~~~R~q~~Al~aLQeaaEayLv~Lfeda~l~A~HAkRvTi~~kDiqLa~rirg~~~  136 (136)
T 1tzy_C           81 TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA  136 (136)
T ss_dssp             TTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEECHHHHHHHHHHHTCCC
T ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccCcHHhHHHHHHHhCcCC
Confidence            99999999999999999999999999999999999999999999999999999864



>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>1r4v_A Hypothetical protein AQ_328; structural genomics, all-alpha, histon fold, PSI, protein ST initiative, midwest center for structural genomics; HET: MSE; 1.90A {Aquifex aeolicus} SCOP: a.22.1.4 Back     alignment and structure
>1wwi_A Hypothetical protein TTHA1479; structural genomics, unknown function, riken structural genomics/proteomics initiative, RSGI; 1.58A {Thermus thermophilus HB8} SCOP: a.22.1.4 PDB: 1wws_A Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1tzyc_95 a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), 4e-56
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 6e-10
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 6e-05
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 7e-05
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 4e-04
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 6e-04
d1tafa_68 a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila mel 0.002
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
 Score =  168 bits (426), Expect = 4e-56
 Identities = 91/95 (95%), Positives = 94/95 (98%)

Query: 42  YRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYL 101
           YRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS AV+ALQEA+EAYL
Sbjct: 1   YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYL 60

Query: 102 VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
           VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Sbjct: 61  VGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 95


>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 100.0
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.43
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.4
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.31
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 99.15
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 99.07
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 98.99
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 98.96
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 98.71
d1q9ca_172 Histone domain of Son of sevenless protein {Human 98.69
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 98.57
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 98.55
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 98.49
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 98.12
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 98.05
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 98.04
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 96.91
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 96.87
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 96.86
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 96.65
d1q9ca_172 Histone domain of Son of sevenless protein {Human 96.34
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 86.07
d1wwia1148 Hypothetical protein TTHA1479 {Thermus thermophilu 83.4
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 81.89
d1r4va_151 Hypothetical protein Aq_328 {Aquifex aeolicus [Tax 81.63
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: Nucleosome core histones
domain: Histone H3
species: Chicken (Gallus gallus), erythrocytes [TaxId: 9031]
Probab=100.00  E-value=9e-48  Score=268.24  Aligned_cols=95  Identities=96%  Similarity=1.361  Sum_probs=93.6

Q ss_pred             cCCCchhhHHHhhhhhhhhhhhhhchhHHHHHHHHhhhhccccccHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCccccC
Q 032681           42 YRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIM  121 (136)
Q Consensus        42 ~~~g~~~l~EIr~~q~st~llipk~pF~Rlvrei~~~~~~~~r~~~~Al~aLqea~E~~lv~lfe~a~~~a~HakRvTi~  121 (136)
                      ||||+++|+|||+||+||++||||+||+||||||++++.+++||+++|+++||||+|+|||++|||||+||+|+||||||
T Consensus         1 ~rpGt~ALrEIRk~Qkst~lLIpk~pF~RLVRei~~~~~~~~r~~~~Al~aLQea~E~yLv~lfeda~~~a~HakRvTl~   80 (95)
T d1tzyc_           1 YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIM   80 (95)
T ss_dssp             CCHHHHHHHHHHHHHHCCSCCSCHHHHHHHHHHHHHHHCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSEEC
T ss_pred             CCCchHHHHHHHHHhCCcccccccccHHHHHHHHHHhcCCCCEeeHHHHHHHHHHHHHHHHHHHHHhHHHHHhcCCCcCC
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHhcccC
Q 032681          122 PKDIQLARRIRGERA  136 (136)
Q Consensus       122 ~kDiqla~rir~~~~  136 (136)
                      ++||+||++|||+++
T Consensus        81 ~kD~~LarrirG~r~   95 (95)
T d1tzyc_          81 PKDIQLARRIRGERA   95 (95)
T ss_dssp             HHHHHHHHHHHTCCC
T ss_pred             HHHHHHHHHHhccCC
Confidence            999999999999975



>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1wwia1 a.22.1.4 (A:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r4va_ a.22.1.4 (A:) Hypothetical protein Aq_328 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure