Query         032696
Match_columns 135
No_of_seqs    27 out of 29
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 04:46:53 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/032696.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/032696hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08507 COPI_assoc:  COPI asso  99.4 1.3E-12 2.8E-17   95.8   9.7   80   46-129     5-84  (136)
  2 PF06151 Trehalose_recp:  Treha  76.5      18 0.00038   31.8   8.1   36   75-110    90-126 (414)
  3 PRK14756 hypothetical protein;  43.5      40 0.00086   20.7   3.1   21   47-67      7-27  (29)
  4 PHA03281 envelope glycoprotein  38.9   1E+02  0.0022   29.8   6.4   41   33-74    546-586 (642)
  5 COG3768 Predicted membrane pro  33.7 1.9E+02  0.0042   26.1   7.0   62   49-110    67-131 (350)
  6 PF13705 TRC8_N:  TRC8 N-termin  32.7      55  0.0012   30.5   3.7   75   40-122   174-248 (508)
  7 TIGR00769 AAA ADP/ATP carrier   31.9 2.8E+02  0.0061   24.9   7.8   71   46-116    44-133 (472)
  8 PF10805 DUF2730:  Protein of u  28.1      84  0.0018   22.6   3.3   30   99-130     2-32  (106)
  9 COG5074 t-SNARE complex subuni  27.4      35 0.00076   29.8   1.4   15   81-95    251-265 (280)
 10 PF11163 DUF2947:  Protein of u  26.8      24 0.00052   28.2   0.3   23   94-117   108-130 (153)
 11 PLN00039 photosystem II reacti  26.6      40 0.00086   25.8   1.4   17   91-107    82-98  (111)
 12 KOG2412 Nuclear-export-signal   26.2      23  0.0005   33.6   0.1   26   75-100   468-498 (591)
 13 PRK13610 photosystem II reacti  26.0      41 0.00089   25.9   1.4   17   91-107    88-104 (113)
 14 PF07444 Ycf66_N:  Ycf66 protei  26.0 2.6E+02  0.0056   20.2   6.7   43   47-89      5-48  (84)
 15 TIGR03047 PS_II_psb28 photosys  25.9      42 0.00091   25.6   1.4   18   90-107    80-97  (109)
 16 KOG2675 Adenylate cyclase-asso  25.5      68  0.0015   29.9   3.0   20   51-70    265-284 (480)
 17 PRK13612 photosystem II reacti  25.4      43 0.00094   25.7   1.4   17   91-107    84-100 (113)
 18 PF11712 Vma12:  Endoplasmic re  23.2 2.6E+02  0.0057   20.7   5.2   14   84-97    115-128 (142)
 19 CHL00128 psbW photosystem II p  23.1      51  0.0011   25.3   1.4   18   90-107    83-100 (113)
 20 PRK13611 photosystem II reacti  22.4      54  0.0012   24.9   1.4   17   91-107    77-93  (104)
 21 KOG1908 Ribonuclease inhibitor  22.4      79  0.0017   25.7   2.4   12   15-26      3-14  (165)
 22 PF05805 L6_membrane:  L6 membr  21.7      92   0.002   25.6   2.7   23   44-66      7-29  (195)
 23 PF02293 AmiS_UreI:  AmiS/UreI   21.1 4.4E+02  0.0096   21.2   6.7   69   47-132    90-159 (166)
 24 PF03912 Psb28:  Psb28 protein;  20.9      56  0.0012   24.9   1.3   12   96-107    86-97  (108)
 25 PF04588 HIG_1_N:  Hypoxia indu  20.6 2.5E+02  0.0053   18.0   4.9   40   55-94     10-52  (54)

No 1  
>PF08507 COPI_assoc:  COPI associated protein;  InterPro: IPR013714 Proteins in this family co-localise with COPI vesicle coat proteins []. In yeast it is a Golgi membrane protein involved in vesicular trafficking, interacting with TVP18 []. 
Probab=99.43  E-value=1.3e-12  Score=95.80  Aligned_cols=80  Identities=21%  Similarity=0.407  Sum_probs=66.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhhccCcccccchhhhHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhhhHHHHHHHHH
Q 032696           46 CYSVLTSLTALLCLAVNVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLEYWVARGMLQILYVLY  125 (135)
Q Consensus        46 ~fs~vTal~AlLCi~vNvlSavrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLeyW~gRGmLQIFvAvm  125 (135)
                      .+.+++.++|+++++..+++.+.+    .++-+.++++|.+++++++.++|.+|.++.|++++|+.|.|||+++||+++|
T Consensus         5 ~~r~~~~~~~~~~i~~gi~~l~~~----~~~~~~i~~~Y~i~fg~ll~~~E~~~~~i~~~~~FL~~~~GRGlfyif~G~l   80 (136)
T PF08507_consen    5 IFRILNIIAGILLILAGILSLFNS----FSFSSFILGVYCILFGLLLILAEFRWPFIRKYFGFLYSYIGRGLFYIFLGTL   80 (136)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhh----hhHHHHHHHHHHHHHHHHHHHHHhccHHHHHhHhHHHhHHHHHHHHHHHHHH
Confidence            455566666666677777776665    3334778999999999999999999999999999999999999999999999


Q ss_pred             HHHh
Q 032696          126 YRLI  129 (135)
Q Consensus       126 T~~~  129 (135)
                      +...
T Consensus        81 ~~~~   84 (136)
T PF08507_consen   81 CLGQ   84 (136)
T ss_pred             HHhh
Confidence            8754


No 2  
>PF06151 Trehalose_recp:  Trehalose receptor;  InterPro: IPR009318 In Drosophila, taste is perceived by gustatory neurons located in sensilla distributed on several different appendages throughout the body of the animal. This family represents the taste receptor sensitive to trehalose [,].
Probab=76.45  E-value=18  Score=31.82  Aligned_cols=36  Identities=14%  Similarity=0.291  Sum_probs=30.4

Q ss_pred             cccch-hhhHHHHHHHHHHHHHhhhHHHHHHHHHHHH
Q 032696           75 DIFDG-IFRCYAVVIAFFVALAETEWQFVLKFTKVLE  110 (135)
Q Consensus        75 dif~G-I~RcYaV~iA~fVvlaETEW~~i~kF~kvLe  110 (135)
                      +-..+ +|-+...++.++....=.+|..+|+-|.-.|
T Consensus        90 ~~~~~liFy~~~~~~~i~Fl~LAr~Wp~lm~~W~~vE  126 (414)
T PF06151_consen   90 NNIASLIFYVVCLLISILFLRLARRWPQLMREWSRVE  126 (414)
T ss_pred             eehhhhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            44455 6889999999888888999999999998876


No 3  
>PRK14756 hypothetical protein; Provisional
Probab=43.47  E-value=40  Score=20.69  Aligned_cols=21  Identities=24%  Similarity=0.317  Sum_probs=17.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHh
Q 032696           47 YSVLTSLTALLCLAVNVLSAI   67 (135)
Q Consensus        47 fs~vTal~AlLCi~vNvlSav   67 (135)
                      ||.+|.+.||..|++..+.|+
T Consensus         7 ~SL~tTvvaL~~Iva~~~ta~   27 (29)
T PRK14756          7 FSLVTTIIVLGLIVAVGLTAA   27 (29)
T ss_pred             hhHHHHHHHHHHHHHHHHHHh
Confidence            789999999998888766553


No 4  
>PHA03281 envelope glycoprotein E; Provisional
Probab=38.93  E-value=1e+02  Score=29.80  Aligned_cols=41  Identities=20%  Similarity=0.302  Sum_probs=27.8

Q ss_pred             CCCCCCceEEehhhhHHHHHHHHHHHHHHHHHHHhhhccCcc
Q 032696           33 LRNRADPLLVVCRCYSVLTSLTALLCLAVNVLSAIRSFKNGS   74 (135)
Q Consensus        33 ~~~~~DplL~vcr~fs~vTal~AlLCi~vNvlSavrsf~~~~   74 (135)
                      ...+.-|++.-.-..+-+ ++.||||+++-.+-..+.|++..
T Consensus       546 s~~~~~p~~~y~~l~~~~-a~~~ll~l~~~~~c~~~~~~~~~  586 (642)
T PHA03281        546 SEPGTFPFKRYAAITGGF-AALALLCLAIALICTAKKFGHKA  586 (642)
T ss_pred             cccCCCCeEeehhhhhhh-HHHHHHHHHHHHHHHHHHhhhhe
Confidence            345567777654333322 46789999999998888887653


No 5  
>COG3768 Predicted membrane protein [Function unknown]
Probab=33.73  E-value=1.9e+02  Score=26.08  Aligned_cols=62  Identities=19%  Similarity=0.187  Sum_probs=45.0

Q ss_pred             HHHHHHHHHHHHHHHHH---HhhhccCcccccchhhhHHHHHHHHHHHHHhhhHHHHHHHHHHHH
Q 032696           49 VLTSLTALLCLAVNVLS---AIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLE  110 (135)
Q Consensus        49 ~vTal~AlLCi~vNvlS---avrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLe  110 (135)
                      .+++...|+|.+|-.-|   ..+.|....-++=|..=+-++++.++|..+=|||-.++|+-++.+
T Consensus        67 ~~~a~~vLf~~Av~~q~~qwi~d~~qr~dWl~~~a~~v~~l~vlagv~~v~rEw~rl~rL~~r~~  131 (350)
T COG3768          67 MLGAGGVLFSLAVGLQSVQWIRDLFQRADWLGLGAAAVGALIVLAGVGSVVREWRRLVRLRQRQH  131 (350)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            36677778887775544   345564444566566667788888999999999999999987653


No 6  
>PF13705 TRC8_N:  TRC8 N-terminal domain
Probab=32.69  E-value=55  Score=30.49  Aligned_cols=75  Identities=24%  Similarity=0.346  Sum_probs=45.5

Q ss_pred             eEEehhhhHHHHHHHHHHHHHHHHHHHhhhccCcccccchhhhHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhhhHHH
Q 032696           40 LLVVCRCYSVLTSLTALLCLAVNVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALAETEWQFVLKFTKVLEYWVARGMLQ  119 (135)
Q Consensus        40 lL~vcr~fs~vTal~AlLCi~vNvlSavrsf~~~~dif~GI~RcYaV~iA~fVvlaETEW~~i~kF~kvLeyW~gRGmLQ  119 (135)
                      ++.++.+-...|++..+--+.-|.....+.-|   .-+.-+.|.||.     ..++|+||.++-==.-..-||..|=..|
T Consensus       174 l~~~~~~a~~~~~~~v~~~~~~~~~~~~~~v~---~~~~~~~~~~Gl-----~~l~~~~W~rL~vP~vl~vFWl~~f~~q  245 (508)
T PF13705_consen  174 LLIVHNFALWLTILEVLYFILSNYPVPYRFVK---TAYRHMYENYGL-----QALVESLWNRLRVPEVLRVFWLTRFAVQ  245 (508)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCccchHHHHH---HHHHHHHHHhhH-----HHHHHHHHhhhcchhhHHHHHHHHHHHH
Confidence            34444444444444444444444443333321   223455677764     5789999999866666667999999999


Q ss_pred             HHH
Q 032696          120 ILY  122 (135)
Q Consensus       120 IFv  122 (135)
                      +..
T Consensus       246 ~~~  248 (508)
T PF13705_consen  246 LYI  248 (508)
T ss_pred             Hhe
Confidence            866


No 7  
>TIGR00769 AAA ADP/ATP carrier protein family. These proteins are members of the ATP:ADP Antiporter (AAA) Family (TC 2.A.12), which consists of nucleotide transporters that have 12 GES predicted transmembrane regions. One protein from Rickettsia prowazekii functions to take up ATP from the eukaryotic cell cytoplasm into the bacterium in exchange for ADP. Five AAA family paralogues are encoded within the genome of R. prowazekii. This organism transports UMP and GMP but not CMP, and it seems likely that one or more of the AAA family paralogues are responsible. The genome of Chlamydia trachomatis encodes two AAA family members, Npt1 and Npt2, which catalyse ATP/ADP exchange and GTP, CTP, ATP and UTP uptake probably employing a proton symport mechanism. Two homologous adenylate translocators of Arabidopsis thaliana are postulated to be localized to the intracellular plastid membrane where they function as ATP importers.
Probab=31.86  E-value=2.8e+02  Score=24.93  Aligned_cols=71  Identities=10%  Similarity=0.154  Sum_probs=43.4

Q ss_pred             hhHHHHHHHHHHHHHH--HHHHHhhhccCcccccchhhhHHHHHHHHHHHHH---h--------------hhHHHHHHHH
Q 032696           46 CYSVLTSLTALLCLAV--NVLSAIRSFKNGSDIFDGIFRCYAVVIAFFVALA---E--------------TEWQFVLKFT  106 (135)
Q Consensus        46 ~fs~vTal~AlLCi~v--NvlSavrsf~~~~dif~GI~RcYaV~iA~fVvla---E--------------TEW~~i~kF~  106 (135)
                      ..+++...+-+-|.++  =+++..-+--..+++|..+.+.+...+.+|-.+.   +              +=-..+..++
T Consensus        44 ~i~fLk~~~~lp~~~~~~~ly~~l~~~~~~~~lf~~~~~~F~~~f~lF~~vl~p~~~~~~p~~~~~~~~~~~~~~~~~~i  123 (472)
T TIGR00769        44 IIPFLKTWVVVPMAVIFMLIYTKLSNILSKEALFYTVISPFLGFFALFAFVIYPLSDLLHPTALADKLLSLLPPGFMGFI  123 (472)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHhHHHHHHHHHHHHHHHHHHHhcchhhcCCcHHHHHHHhhcchhhHHHH
Confidence            4555555443333333  2222222222236899999999999998887772   1              1123466788


Q ss_pred             HHHHHHhhhh
Q 032696          107 KVLEYWVARG  116 (135)
Q Consensus       107 kvLeyW~gRG  116 (135)
                      .++.+|..+.
T Consensus       124 ~~~~~W~~~~  133 (472)
T TIGR00769       124 AILRIWSFAL  133 (472)
T ss_pred             HHHhhhhHHH
Confidence            9999999985


No 8  
>PF10805 DUF2730:  Protein of unknown function (DUF2730);  InterPro: IPR020269 This entry represents a family of various hypothetical proteins. The proteins, which include HI1498 and Gp25, from phage Mu, are currently uncharacterised.
Probab=28.10  E-value=84  Score=22.64  Aligned_cols=30  Identities=23%  Similarity=0.494  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHHHHHhhhh-HHHHHHHHHHHHhh
Q 032696           99 WQFVLKFTKVLEYWVARG-MLQILYVLYYRLIL  130 (135)
Q Consensus        99 W~~i~kF~kvLeyW~gRG-mLQIFvAvmT~~~~  130 (135)
                      |++|.|.|.+  .|.+=| ...+|.+.|++.|.
T Consensus         2 ~~~~~~~w~i--i~a~~~~~~~~~~~~l~~~~a   32 (106)
T PF10805_consen    2 WEFIKKNWGI--IWAVFGIAGGIFWLWLRRTYA   32 (106)
T ss_pred             hHHHHhCcHH--HHHHHHHHHHHHHHHHHHhhc
Confidence            7888888888  566655 55677777777654


No 9  
>COG5074 t-SNARE complex subunit, syntaxin [Intracellular trafficking and secretion]
Probab=27.39  E-value=35  Score=29.76  Aligned_cols=15  Identities=20%  Similarity=0.820  Sum_probs=12.0

Q ss_pred             hhHHHHHHHHHHHHH
Q 032696           81 FRCYAVVIAFFVALA   95 (135)
Q Consensus        81 ~RcYaV~iA~fVvla   95 (135)
                      .|||+|+|.++++++
T Consensus       251 i~c~gI~~iii~viv  265 (280)
T COG5074         251 IRCYGICFIIIIVIV  265 (280)
T ss_pred             eehhhhHHHHHHHHH
Confidence            589999988877654


No 10 
>PF11163 DUF2947:  Protein of unknown function (DUF2947);  InterPro: IPR021334  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=26.78  E-value=24  Score=28.19  Aligned_cols=23  Identities=22%  Similarity=0.447  Sum_probs=17.9

Q ss_pred             HHhhhHHHHHHHHHHHHHHhhhhH
Q 032696           94 LAETEWQFVLKFTKVLEYWVARGM  117 (135)
Q Consensus        94 laETEW~~i~kF~kvLeyW~gRGm  117 (135)
                      ++||.|+-+.|-||-+-|- .-|+
T Consensus       108 iiET~W~vFkr~WknFLF~-ddGp  130 (153)
T PF11163_consen  108 IIETRWDVFKRNWKNFLFY-DDGP  130 (153)
T ss_pred             EEEeehHHHHHHHHHHhcc-cCcc
Confidence            5799999999999987654 3443


No 11 
>PLN00039 photosystem II reaction center Psb28 protein; Provisional
Probab=26.61  E-value=40  Score=25.82  Aligned_cols=17  Identities=24%  Similarity=0.681  Sum_probs=12.8

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 032696           91 FVALAETEWQFVLKFTK  107 (135)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (135)
                      ++.=-|.||+++|+|-.
T Consensus        82 y~m~s~~~WdRFMRFMe   98 (111)
T PLN00039         82 YVMRSPREWDRFMRFME   98 (111)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            34445889999999964


No 12 
>KOG2412 consensus Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor [RNA processing and modification]
Probab=26.18  E-value=23  Score=33.62  Aligned_cols=26  Identities=35%  Similarity=0.569  Sum_probs=22.8

Q ss_pred             ccc----chhhhHHHHHHHHHH-HHHhhhHH
Q 032696           75 DIF----DGIFRCYAVVIAFFV-ALAETEWQ  100 (135)
Q Consensus        75 dif----~GI~RcYaV~iA~fV-vlaETEW~  100 (135)
                      |.|    +||+|.||.+|.+=. ..+=|+|+
T Consensus       468 d~YleRm~Gi~rLYAAIi~l~~p~~~~~~~h  498 (591)
T KOG2412|consen  468 DAYLERMDGIMRLYAAIIQLDIPVGNATNVH  498 (591)
T ss_pred             chHHHHhHhHHHHHHHHHHhcccccCCCCCC
Confidence            788    899999999999887 78888877


No 13 
>PRK13610 photosystem II reaction center protein Psb28; Provisional
Probab=26.05  E-value=41  Score=25.91  Aligned_cols=17  Identities=12%  Similarity=0.321  Sum_probs=12.5

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 032696           91 FVALAETEWQFVLKFTK  107 (135)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (135)
                      ++.=-|.||+++|+|-.
T Consensus        88 y~m~s~~~WdRFMRFMe  104 (113)
T PRK13610         88 YNWNSEEAFERFMRFAS  104 (113)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            33445889999999954


No 14 
>PF07444 Ycf66_N:  Ycf66 protein N-terminus;  InterPro: IPR010004 This entry represents Ycf66, a protein that is restricted to the chloroplasts of simple plants and algae. It is also found in the cyanobacteria. The function is unknown. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=26.04  E-value=2.6e+02  Score=20.20  Aligned_cols=43  Identities=21%  Similarity=0.239  Sum_probs=28.2

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhccCc-ccccchhhhHHHHHHH
Q 032696           47 YSVLTSLTALLCLAVNVLSAIRSFKNG-SDIFDGIFRCYAVVIA   89 (135)
Q Consensus        47 fs~vTal~AlLCi~vNvlSavrsf~~~-~dif~GI~RcYaV~iA   89 (135)
                      |+.-+.++.++-++...+-..|.++.. ++.+|=++=.-+.+.+
T Consensus         5 ~~~~~iLgi~l~~~~~~Ly~lr~~~Pev~Rd~D~~fs~vgLl~g   48 (84)
T PF07444_consen    5 FGPSYILGIILILGGLALYFLRFFRPEVSRDYDIFFSSVGLLYG   48 (84)
T ss_pred             cCHHHHHHHHHHHHHHHHHHHHHHCcchhhhhhHHHHHHHHHHH
Confidence            456677888888889999999999877 4444433333333333


No 15 
>TIGR03047 PS_II_psb28 photosystem II reaction center protein Psb28. Members of this protein family are the Psb28 protein of photosystem II. Two different protein families, apparently without homology between them, have been designated PsbW. Cyanobacterial proteins previously designated PsbW are members of the family described here. However, while members of the plant PsbW family are not found (so far) in Cyanobacteria, members of the present family do occur in plants. We therefore support the alternative designation that has emerged for this protein family, Psp28, rather than PsbW.
Probab=25.94  E-value=42  Score=25.63  Aligned_cols=18  Identities=22%  Similarity=0.720  Sum_probs=13.5

Q ss_pred             HHHHHHhhhHHHHHHHHH
Q 032696           90 FFVALAETEWQFVLKFTK  107 (135)
Q Consensus        90 ~fVvlaETEW~~i~kF~k  107 (135)
                      .++.=-|.||+++|+|-.
T Consensus        80 ~y~m~s~~~WdRFMRFme   97 (109)
T TIGR03047        80 VYIMKSEDEWDRFMRFME   97 (109)
T ss_pred             EEEECCHHHHHHHHHHHH
Confidence            344456889999999964


No 16 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=25.53  E-value=68  Score=29.92  Aligned_cols=20  Identities=20%  Similarity=0.209  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHHHHhhhc
Q 032696           51 TSLTALLCLAVNVLSAIRSF   70 (135)
Q Consensus        51 Tal~AlLCi~vNvlSavrsf   70 (135)
                      .+|.|=|--.-++-|.+|+-
T Consensus       265 ~AlFaqlNqGe~iTsgLkkV  284 (480)
T KOG2675|consen  265 GALFAQLNQGEGITSGLKKV  284 (480)
T ss_pred             HHHHHHHhccchhhhhhhhC
Confidence            34555555555666666654


No 17 
>PRK13612 photosystem II reaction center protein Psb28; Provisional
Probab=25.44  E-value=43  Score=25.70  Aligned_cols=17  Identities=24%  Similarity=0.704  Sum_probs=12.7

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 032696           91 FVALAETEWQFVLKFTK  107 (135)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (135)
                      ++.=-|.||+++|+|-.
T Consensus        84 y~m~s~~~WdRFMRFMe  100 (113)
T PRK13612         84 YIWKSEQEWDRFMRFME  100 (113)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            34445889999999964


No 18 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=23.22  E-value=2.6e+02  Score=20.68  Aligned_cols=14  Identities=29%  Similarity=0.342  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHhh
Q 032696           84 YAVVIAFFVALAET   97 (135)
Q Consensus        84 YaV~iA~fVvlaET   97 (135)
                      -+++.|++|.+||+
T Consensus       115 lgl~~al~vlvAEv  128 (142)
T PF11712_consen  115 LGLFGALLVLVAEV  128 (142)
T ss_pred             HHHHHHHHHHHHHH
Confidence            46778888999997


No 19 
>CHL00128 psbW photosystem II protein W; Reviewed
Probab=23.11  E-value=51  Score=25.32  Aligned_cols=18  Identities=11%  Similarity=0.567  Sum_probs=13.3

Q ss_pred             HHHHHHhhhHHHHHHHHH
Q 032696           90 FFVALAETEWQFVLKFTK  107 (135)
Q Consensus        90 ~fVvlaETEW~~i~kF~k  107 (135)
                      .++.=-|.||+++|+|-.
T Consensus        83 ~y~m~s~~~WdRFMRFMe  100 (113)
T CHL00128         83 IYIMKNPEAWDRFMRFME  100 (113)
T ss_pred             EEEECCHHHHHHHHHHHH
Confidence            344456889999999964


No 20 
>PRK13611 photosystem II reaction center protein Psb28; Provisional
Probab=22.43  E-value=54  Score=24.89  Aligned_cols=17  Identities=29%  Similarity=0.655  Sum_probs=12.7

Q ss_pred             HHHHHhhhHHHHHHHHH
Q 032696           91 FVALAETEWQFVLKFTK  107 (135)
Q Consensus        91 fVvlaETEW~~i~kF~k  107 (135)
                      ++.--|.||+++|+|-.
T Consensus        77 y~m~s~~~wdRFMRFme   93 (104)
T PRK13611         77 YDMETEAEWDRFLRFME   93 (104)
T ss_pred             EEECCHHHHHHHHHHHH
Confidence            34445889999999964


No 21 
>KOG1908 consensus Ribonuclease inhibitor type leucine-rich repeat proteins [RNA processing and modification]
Probab=22.35  E-value=79  Score=25.71  Aligned_cols=12  Identities=33%  Similarity=0.603  Sum_probs=7.6

Q ss_pred             CCCCCCCCCCCC
Q 032696           15 PPQPQPPPPPAR   26 (135)
Q Consensus        15 ~~~p~~~~~~~~   26 (135)
                      +|+||||++++.
T Consensus         3 A~p~~~~sh~Aa   14 (165)
T KOG1908|consen    3 APPEAPPSHGAA   14 (165)
T ss_pred             CCCCCCCCCCCc
Confidence            456677776664


No 22 
>PF05805 L6_membrane:  L6 membrane protein;  InterPro: IPR008661 This family consists of several eukaryotic L6 membrane proteins. L6, IL-TMP, and TM4SF5 are cell surface proteins predicted to have four transmembrane domains. Previous sequence analysis led to their assignment as members of the tetraspanin superfamily it has now been found that that they are not significantly related to genuine tetraspanins, but instead constitute their own L6 family []. Several members of this family have been implicated in Homo sapiens cancer [, ].; GO: 0016021 integral to membrane
Probab=21.69  E-value=92  Score=25.64  Aligned_cols=23  Identities=35%  Similarity=0.560  Sum_probs=19.7

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHH
Q 032696           44 CRCYSVLTSLTALLCLAVNVLSA   66 (135)
Q Consensus        44 cr~fs~vTal~AlLCi~vNvlSa   66 (135)
                      -||..+.-...|++|+++|.+--
T Consensus         7 arclG~sLl~Lal~~iiaNilL~   29 (195)
T PF05805_consen    7 ARCLGFSLLPLALLCIIANILLF   29 (195)
T ss_pred             hhhhhhHHHHHHHHHHHHHHhee
Confidence            37888888899999999999943


No 23 
>PF02293 AmiS_UreI:  AmiS/UreI family transporter;  InterPro: IPR003211  Helicobacter pylori is a Gram-negative, ureolytic bacteria that can colonise the human stomach. It does not survive in a medium with a pH less than 4.0 unless urea is present, preferring a neutral pH. Gastric juice urea is able to rapidly access intrabacterial urease when the periplasmic pH falls below approximately 6.2 owing to pH-gating of a urea channel, UreI. UreI is a six-transmembrane segment protein that is homologous to the amiS genes of the amidase gene cluster and to UreI of Helicobacter hepaticus and Streptococcus salivarius. UreI in H. pylori and H. hepaticus can transport urea only at acidic pH, whereas that of S. salivarius is open at both neutral and acidic pH []. The amiS gene encodes an 18kDa protein with a high content of hydrophobic residues. It has six transmembrane helices. AmiB and AmiS resemble two components of an ABC transporter system []. This family includes UreI and proton gated urea channel as well as putative amide transporters [].; GO: 0006810 transport, 0016020 membrane
Probab=21.14  E-value=4.4e+02  Score=21.19  Aligned_cols=69  Identities=29%  Similarity=0.340  Sum_probs=45.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhccCcccccch-hhhHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHhhhhHHHHHHHHH
Q 032696           47 YSVLTSLTALLCLAVNVLSAIRSFKNGSDIFDG-IFRCYAVVIAFFVALAETEWQFVLKFTKVLEYWVARGMLQILYVLY  125 (135)
Q Consensus        47 fs~vTal~AlLCi~vNvlSavrsf~~~~dif~G-I~RcYaV~iA~fVvlaETEW~~i~kF~kvLeyW~gRGmLQIFvAvm  125 (135)
                      ||...+++|+...       +.+|.+..|.--| |-=.+++++.+|-++.-.+- .+.||.         |.+.|++++.
T Consensus        90 fsLFVAi~a~~~a-------~~~~~~~~d~~~~~~W~~Wa~LW~lfFl~l~L~k-~l~~~~---------g~~~i~~gi~  152 (166)
T PF02293_consen   90 FSLFVAITALPYA-------ILSFSGAGDPWFAVIWLAWAVLWFLFFLLLALKK-PLGKFT---------GWLAIVEGIV  152 (166)
T ss_pred             HHHHHHHHHHHHH-------HHHHcccccHHHHHHHHHHHHHHHHHHHHHhcCC-cchhHH---------HHHHHHHHHH
Confidence            4555555555443       4445544555555 57899999999776665554 555654         5567888888


Q ss_pred             HHHhhhc
Q 032696          126 YRLILFY  132 (135)
Q Consensus       126 T~~~~~~  132 (135)
                      |--+|.+
T Consensus       153 T~wiPg~  159 (166)
T PF02293_consen  153 TAWIPGF  159 (166)
T ss_pred             HHHHHHH
Confidence            8877764


No 24 
>PF03912 Psb28:  Psb28 protein;  InterPro: IPR005610 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein Psb28 (PsbW) found in PSII, where it is a subunit of the oxygen-evolving complex. Psb28 appears to have several roles, including guiding PSII biogenesis and assembly, stabilising dimeric PSII [], and facilitating PSII repair after photo-inhibition []. There appears to be two classes of Psb28, class 1 being found predominantly in algae and cyanobacteria, and class 2 being found predominantly in plants. This entry represents class 1 Psb28.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0016020 membrane; PDB: 2KVO_A.
Probab=20.88  E-value=56  Score=24.88  Aligned_cols=12  Identities=33%  Similarity=0.894  Sum_probs=10.1

Q ss_pred             hhhHHHHHHHHH
Q 032696           96 ETEWQFVLKFTK  107 (135)
Q Consensus        96 ETEW~~i~kF~k  107 (135)
                      +-||+++|+|-.
T Consensus        86 ~~~WdRFMRFMe   97 (108)
T PF03912_consen   86 EEEWDRFMRFME   97 (108)
T ss_dssp             SHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHH
Confidence            679999999964


No 25 
>PF04588 HIG_1_N:  Hypoxia induced protein conserved region;  InterPro: IPR007667 The hypoxia induced gene 1 (HIG1) or hypoglycemia/hypoxia inducible mitochondrial protein (HIMP1) is up-regulated by stresses of the microenvironment such as low oxygen or low glucose conditions. HIG1 is a mitochondrial inner membrane protein, which is ubiquitously expressed. It is predicted to be an integral membrane protein consisting of two hydrophobic helices, 21-23 residues in length that might tend to form a hairpin-like loop across the bilayer. HIG1 could be implied in apoptotic or cytoprotective signals. HIG1 is a member of a well conserved eukaryote protein family. The predicted transmembrane helice (TMH) and loop regions represent the most highly conserved regions in these proteins [, ]. The profile we developed covers the predicted TMH and loop regions. This domain is found in proteins thought to be involved in the response to hypoxia []. It is also found in altered inheritance of mitochondria proteins.; PDB: 2LOM_A 2LON_A.
Probab=20.57  E-value=2.5e+02  Score=18.01  Aligned_cols=40  Identities=15%  Similarity=0.221  Sum_probs=23.4

Q ss_pred             HHHHHHHHHHHHhhhccCcccccch-h--hhHHHHHHHHHHHH
Q 032696           55 ALLCLAVNVLSAIRSFKNGSDIFDG-I--FRCYAVVIAFFVAL   94 (135)
Q Consensus        55 AlLCi~vNvlSavrsf~~~~dif~G-I--~RcYaV~iA~fVvl   94 (135)
                      ++++++.=+....++|+.++..-.. +  .|+|+=.+++...+
T Consensus        10 g~~~~~~~l~~g~~~~~~g~~~~s~klmr~RV~aQ~~tv~~l~   52 (54)
T PF04588_consen   10 GMLATVGALAYGLYNFRRGNMKTSQKLMRARVYAQGLTVAALV   52 (54)
T ss_dssp             HHHHHHHHHHHHHHHHTSSS----SSSSS-SHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhcCCChHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444444467778888877443344 3  69998777776654


Done!